Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate AMM18 coat protein gene, complete cds.

ACC No: HQ012400

Dated: 2011-01-16 | Length: 672 | CRC: 581408941

                
ID   HQ012400; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   HQ012400;
XX
DT   16-JAN-2011 (Rel. 107, Created)
DT   16-JAN-2011 (Rel. 107, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate AMM18 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Ayazpour K., Sijam K., Vadamalai G., Jaafar H.;
RT   ;
RL   Submitted (03-AUG-2010) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Protection, Faculty of Agriculture, University Putra
RL   Malaysia, Upm Darul Ehsan, Serdang, Selangor 43400, Malaysia
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus aurantifolia"
FT                   /isolate="AMM18"
FT                   /mol_type="genomic RNA"
FT                   /country="Malaysia:Marang"
FT                   /collection_date="Feb-2010"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ADV15585.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGMT
FT                   YTREGVEVELSDKLWTDVVFNSKGIGNRTNALRVWGRSNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVIVTNVRQLGKFTP
FT                   R"
XX
SQ   Sequence 672 BP; 202 A; 125 C; 165 G; 180 T; 0 other;

hq012400 Length: 672  16-JAN-2011  Type: N  Check: 1581  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgcag ctgagtcttc tttcggttcc gtaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggtacc
     151  caacagaatg ctgctttgaa tagagatttg tttcttactt tgaaagggaa
     201  gtatcctaac ttacctgaca aagataaaga ctttcacata gctatgatgt
     251  tatatcgttt agcagttaag agttcatcat tacaaagcga cgatgatacc
     301  acgggtatga cgtacactcg agaaggtgtt gaagtggaat tgtctgacaa
     351  actttggaca gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  acgcccttcg agtctggggt agaagtaacg atgcccttta tttggctttt
     451  tgtagacaga accgcaactt aagttatggt ggacgtccgt tagacgcagg
     501  aattccagcc gggtatcact acctgtgtgc agatttcttg accggagccg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agagcaatta
     601  ttaaagaagc gaggggctga tgaagtcata gttactaatg tcaggcagct
     651  tgggaaattc accccacgtt ga