Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate AMM28 coat protein gene, complete cds.

ACC No: HQ012403

Dated: 2011-01-16 | Length: 672 | CRC: -2007709025

                
ID   HQ012403; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   HQ012403;
XX
DT   16-JAN-2011 (Rel. 107, Created)
DT   16-JAN-2011 (Rel. 107, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate AMM28 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Ayazpour K., Sijam K., Vadamalai G., Jaafar H.;
RT   ;
RL   Submitted (03-AUG-2010) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Protection, Faculty of Agriculture, University Putra
RL   Malaysia, Upm Darul Ehsan, Serdang, Selangor 43400, Malaysia
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus limonia"
FT                   /isolate="AMM28"
FT                   /mol_type="genomic RNA"
FT                   /country="Malaysia:Marang"
FT                   /collection_date="Feb-2010"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ADV15587.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSLNLHIDPTLITMNDV
FT                   RQLSTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVELSDKLWTDVVYNSKGIGKRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVIVTNVRQLGKFTP
FT                   R"
XX
SQ   Sequence 672 BP; 202 A; 124 C; 165 G; 181 T; 0 other;

hq012403 Length: 672  16-JAN-2011  Type: N  Check: 1295  ..

       1  atggacgacg aaacaaagaa attgaagaat aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgcgg ctgagtcttc tttcggttcc ttaaacttac
     101  acatcgatcc gactctgata acgatgaacg atgtgcgtca gttgagtact
     151  caacaaaatg ctgctttgaa cagggactta tttcttactc tgaaagggaa
     201  gtatcctaac ttgcctgaca aagataaaga ctttcacata gctatgatgt
     251  tataccgttt agcggttaaa agttcatcat tgcaaagtga tgatgacacc
     301  acgggcataa cgtacactcg ggagggtgtt gaagtagagt tgtctgacaa
     351  actttggacc gacgtcgtat ataattctaa gggtattggt aaacgaacta
     401  acgcccttcg agtctggggt agaactaacg atgctcttta cttagccttt
     451  tgtagacaga accgcaattt gagttatggc ggacgtccac tagatgcagg
     501  gattccggcc gggtatcatt atctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaaaaagc gaggggctga tgaggttata gttactaatg tcaggcagct
     651  tgggaaattc accccacgtt ga