Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate AMSB2 coat protein gene, complete cds.

ACC No: HQ012405

Dated: 2011-01-16 | Length: 672 | CRC: 782630641

                
ID   HQ012405; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   HQ012405;
XX
DT   16-JAN-2011 (Rel. 107, Created)
DT   16-JAN-2011 (Rel. 107, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate AMSB2 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Ayazpour K., Sijam K., Vadamalai G., Jaafar H.;
RT   ;
RL   Submitted (03-AUG-2010) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Protection, Faculty of Agriculture, University Putra
RL   Malaysia, Upm Darul Ehsan, Serdang, Selangor 43400, Malaysia
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="x Citrofortunella microcarpa"
FT                   /isolate="AMSB2"
FT                   /mol_type="genomic RNA"
FT                   /country="Malaysia:Serdang"
FT                   /collection_date="Jan-2010"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ADV15589.1"
FT                   /translation="MDGETKKLKNKNKETKEGDDVVAAESSFGSMNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTRDGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAWYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEFVVTNVRQLGKFTT
FT                   R"
XX
SQ   Sequence 672 BP; 191 A; 125 C; 174 G; 182 T; 0 other;

hq012405 Length: 672  16-JAN-2011  Type: N  Check: 3617  ..

       1  atggacggcg aaacaaagaa attgaagaac aaaaacaagg agacgaaaga
      51  aggcgacgat gttgttgcag cagagtcttc tttcggttcc atgaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggaacc
     151  caacagaacg ccgctttgaa cagagatttg tttcttactt tgaaagggaa
     201  gtatcctaac ttgcctgaca aggataaaga cttccacata gctatgatgt
     251  tatatcgttt agcggttaag agttcatcgt tgcaaagtga tgatgacacc
     301  acgggcataa catatactcg ggatggtgtt gaagtggatt tgtctgacaa
     351  gctttggact gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  atgcccttcg agtctggggt aggactaacg atgcccttta tttagctttc
     451  tgtagacaga atcgcaattt gagttatggt ggacgtccgc tagacgcagg
     501  aattccggcc tggtatcatt acctatgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gcagtgtaca tacaagctaa ggaacaattg
     601  ttgaagaagc gaggggctga tgagttcgta gttactaatg tcaggcagct
     651  tgggaaattc accacacgtt ga