Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate AMT4 coat protein gene, complete cds.

ACC No: HQ012410

Dated: 2011-01-16 | Length: 672 | CRC: 571520106

                
ID   HQ012410; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   HQ012410;
XX
DT   16-JAN-2011 (Rel. 107, Created)
DT   16-JAN-2011 (Rel. 107, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate AMT4 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Ayazpour K., Sijam K., Vadamalai G., Jaafar H.;
RT   ;
RL   Submitted (03-AUG-2010) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Protection, Faculty of Agriculture, University Putra
RL   Malaysia, Upm Darul Ehsan, Serdang, Selangor 43400, Malaysia
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus aurantifolia"
FT                   /isolate="AMT4"
FT                   /mol_type="genomic RNA"
FT                   /country="Malaysia:Tanjung Karang"
FT                   /collection_date="Feb-2010"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ADV15594.1"
FT                   /translation="MEGPTKKLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLSDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPGRYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFPP
FT                   R"
XX
SQ   Sequence 672 BP; 188 A; 127 C; 177 G; 180 T; 0 other;

hq012410 Length: 672  16-JAN-2011  Type: N  Check: 4453  ..

       1  atggaggggc cgacaaagaa attgaagaac aaaaacaagg agacaaaaga
      51  aggcgacgat gttgttgcag cagagtcttc tttcggttcc gtgaacttac
     101  acatcgatcc aactctgata gcgatgaacg atgtgcgtca gttgggtact
     151  caacagaatg ctgctttgaa tagagatttg tttcttacct tgaaagggaa
     201  gtatcctaac ttgtccgaca aggataaaga cttccacata gctatgatgt
     251  tatatcgttt agcagttaag agttcatcat tgcaaagtga cgatgacacc
     301  acgggtataa cgtacactcg ggagggtgtt gaagtggatt tgtctgacaa
     351  actttggact gacgtcgtgt ttaactctaa gggtattgga aaccgtacta
     401  acgcccttcg agtctggggt agaactaacg atgcccttta tttggctttt
     451  tgtagacaga accgcaattt gagttatggt ggacgtccgc tagatgcagg
     501  aattccaggc cgatatcatt acctgtgtgc ggatttcttg accggagctg
     551  gcttgactga tttagaatgt gcggtgtaca tacaagctaa agagcaattg
     601  ttgaagaagc gaggggctga tgaggtcgta gtcactaatg tcaggcagct
     651  tgggaaattc cccccccgtt ga