Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate AMT14 coat protein gene, complete cds.

ACC No: HQ012416

Dated: 2011-01-16 | Length: 672 | CRC: -210017804

                
ID   HQ012416; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   HQ012416;
XX
DT   16-JAN-2011 (Rel. 107, Created)
DT   16-JAN-2011 (Rel. 107, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate AMT14 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Ayazpour K., Sijam K., Vadamalai G., Jaafar H.;
RT   ;
RL   Submitted (03-AUG-2010) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Protection, Faculty of Agriculture, University Putra
RL   Malaysia, Upm Darul Ehsan, Serdang, Selangor 43400, Malaysia
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus hystrix"
FT                   /isolate="AMT14"
FT                   /mol_type="genomic RNA"
FT                   /country="Malaysia:Tanjung Karang"
FT                   /collection_date="Feb-2010"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ADV15600.1"
FT                   /translation="MDDETKKLKNKNKESKEGDDVVATESSFSSVNLHIDPTLITMNDV
FT                   RQLSTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSRGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 199 A; 122 C; 165 G; 186 T; 0 other;

hq012416 Length: 672  16-JAN-2011  Type: N  Check: 4085  ..

       1  atggacgacg aaacaaagaa attaaagaac aaaaacaagg aatcgaaaga
      51  aggcgacgat gttgttgcta ccgagtcttc tttcagttcc gtaaacttac
     101  acatcgatcc gactttgata acgatgaacg atgtgcgtca gttgagtacc
     151  caacagaacg ctgctttgaa cagagactta ttccttacct tgaaagggaa
     201  gtatcctaac ttacctgata aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcagttaag agttcatcat tacaaagcga tgacgacacc
     301  acgggtataa cgtacactcg ggaaggtgtt gaagtggatt tgtctgataa
     351  actttggact gacgtcgtgt ttaactctag gggtattggt aaccgtacta
     401  acgcccttcg agtttggggt agaactaacg atgcccttta cttagctttt
     451  tgcagacaga atcgcaatct gagttatggc ggacgtccgc tagatgcagg
     501  gattccagcc gggtatcatt atttgtgtgc ggatttcttg actggagctg
     551  gtttgactga tttagagtgt gctgtgtaca tacaagctaa agaacaatta
     601  ttgaagaagc gaggggctga tgaagttgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga