Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate AMT15 coat protein gene, complete cds.

ACC No: HQ012417

Dated: 2011-01-16 | Length: 672 | CRC: 652055551

                
ID   HQ012417; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   HQ012417;
XX
DT   16-JAN-2011 (Rel. 107, Created)
DT   16-JAN-2011 (Rel. 107, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate AMT15 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Ayazpour K., Sijam K., Vadamalai G., Jaafar H.;
RT   ;
RL   Submitted (03-AUG-2010) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Protection, Faculty of Agriculture, University Putra
RL   Malaysia, Upm Darul Ehsan, Serdang, Selangor 43400, Malaysia
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="x Citrofortunella microcarpa"
FT                   /isolate="AMT15"
FT                   /mol_type="genomic RNA"
FT                   /country="Malaysia:Tanjung Karang"
FT                   /collection_date="Feb-2010"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ADV15601.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSMNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTRDGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAWYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGNSHQ
FT                   R"
XX
SQ   Sequence 672 BP; 192 A; 125 C; 174 G; 181 T; 0 other;

hq012417 Length: 672  16-JAN-2011  Type: N  Check: 2364  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg agacgaaaga
      51  aggcgacgat gttgttgcag cagagtcttc tttcggttcc atgaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggaacc
     151  caacagaacg ccgctttgaa cagagatttg tttcttactc tgaaagggaa
     201  gtatcctaac ttgcctgaca aggataagga ctttcacata gctatgatgt
     251  tatatcgttt agcggttaag agttcatcat tgcaaagtga tgatgacacc
     301  acgggcataa catacactcg ggatggtgtt gaagtggatt tgtctgacaa
     351  gctttggact gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  atgcccttcg agtctggggt agaactaacg atgcccttta tttggctttc
     451  tgtagacaga atcgcaattt gagttatggt ggacgtccgc tagatgcagg
     501  aattccagcc tggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gcggtgtaca tacaagctaa ggaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttactaatg tcaggcagct
     651  tgggaattca caccaacgtt ga