Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate AMT21 coat protein gene, complete cds.

ACC No: HQ012418

Dated: 2011-01-16 | Length: 672 | CRC: 1077902633

                
ID   HQ012418; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   HQ012418;
XX
DT   16-JAN-2011 (Rel. 107, Created)
DT   16-JAN-2011 (Rel. 107, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate AMT21 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Ayazpour K., Sijam K., Vadamalai G., Jaafar H.;
RT   ;
RL   Submitted (03-AUG-2010) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Protection, Faculty of Agriculture, University Putra
RL   Malaysia, Upm Darul Ehsan, Serdang, Selangor 43400, Malaysia
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus hystrix"
FT                   /isolate="AMT21"
FT                   /mol_type="genomic RNA"
FT                   /country="Malaysia:Tanjung Karang"
FT                   /collection_date="Feb-2010"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ADV15602.1"
FT                   /translation="MDGRTKKLKNKNKKTKEVDDVVAAESSFGSVNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHLAMMLYRLAVKSSSLQSDDDTTGMT
FT                   YTREGVEVELSDKLWTDVVFNFKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVIVTNVRQLGKFNP
FT                   R"
XX
SQ   Sequence 672 BP; 203 A; 125 C; 163 G; 181 T; 0 other;

hq012418 Length: 672  16-JAN-2011  Type: N  Check: 1011  ..

       1  atggacggac gaacaaagaa attgaagaac aaaaacaaga aaacgaaaga
      51  agtcgacgat gttgttgcag ctgaatcttc tttcggttcc gtaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggtacc
     151  caacagaacg ctgctttgaa tagagatttg tttcttacct tgaaagggaa
     201  gtatcctaac ttacctgaca aagataaaga ctttcactta gctatgatgt
     251  tatatcgttt agcagttaag agttcatcat tacaaagcga cgatgatacc
     301  acgggtatga cgtacactcg ggaaggtgtt gaagtggaat tatctgacaa
     351  actttggaca gacgtcgtgt ttaactttaa gggtattggt aaccgtacaa
     401  acgcccttcg agtctggggt agaactaacg atgcccttta tttggctttt
     451  tgtagacaga accgcaactt gagttatggt ggacgtccgt tagacgcagg
     501  aattccagcc gggtatcact acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agagcaatta
     601  ttaaagaagc gaggggctga tgaagtcata gttactaatg tcaggcagct
     651  tgggaaattc aacccacgtt ga