Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate AMT28 coat protein gene, complete cds.

ACC No: HQ012420

Dated: 2011-01-16 | Length: 672 | CRC: 127985042

                
ID   HQ012420; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   HQ012420;
XX
DT   16-JAN-2011 (Rel. 107, Created)
DT   16-JAN-2011 (Rel. 107, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate AMT28 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Ayazpour K., Sijam K., Vadamalai G., Jaafar H.;
RT   ;
RL   Submitted (03-AUG-2010) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Protection, Faculty of Agriculture, University Putra
RL   Malaysia, Upm Darul Ehsan, Serdang, Selangor 43400, Malaysia
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus hystrix"
FT                   /isolate="AMT28"
FT                   /mol_type="genomic RNA"
FT                   /country="Malaysia:Tanjung Karang"
FT                   /collection_date="Feb-2010"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ADV15604.1"
FT                   /translation="MDDETKKLKNKNKEIKEGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLSDKDKDFHLAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFTP
FT                   R"
XX
SQ   Sequence 672 BP; 195 A; 127 C; 167 G; 183 T; 0 other;

hq012420 Length: 672  16-JAN-2011  Type: N  Check: 4143  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaaag aaataaaaga
      51  aggcgacgat gttgttgcag ccgagtcttc tttcggttcc ttaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggtacc
     151  caacagaatg ccgctttgaa cagagatttg tttcttacct tgaaagggaa
     201  gtatcctaac ttgtctgaca aagataaaga ctttcactta gccatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tacaaagcga cgatgacacc
     301  acgggcataa cgtacactcg ggagggtgtt gaagtggatt tgtctgacaa
     351  actttggact gacgtcgtgt ttaactctaa aggtattggt aaccgtacta
     401  acgctcttcg agtctggggt agaactaacg atgcccttta tttggctttt
     451  tgtagacaaa accgcaattt gagttatggt ggacgtccgt tagatgcggg
     501  aattccagcc gggtatcact acctgtgtgc agatttcttg accggagctg
     551  gcttaactga tttagaatgt gctgtgtaca tacaagctaa agagcaattg
     601  ttaaagaagc gaggggctga tgaggtcgta gttactaatg tcaggcagct
     651  tgggaaattc acaccccgtt ga