Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate AMT36 coat protein gene, complete cds.

ACC No: HQ012424

Dated: 2011-01-16 | Length: 672 | CRC: -1490819920

                
ID   HQ012424; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   HQ012424;
XX
DT   16-JAN-2011 (Rel. 107, Created)
DT   16-JAN-2011 (Rel. 107, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate AMT36 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Ayazpour K., Sijam K., Vadamalai G., Jaafar H.;
RT   ;
RL   Submitted (03-AUG-2010) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Protection, Faculty of Agriculture, University Putra
RL   Malaysia, Upm Darul Ehsan, Serdang, Selangor 43400, Malaysia
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus aurantifolia"
FT                   /isolate="AMT36"
FT                   /mol_type="genomic RNA"
FT                   /country="Malaysia:Tanjung Karang"
FT                   /collection_date="Feb-2010"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ADV15607.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLITMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDATGIT
FT                   YTRGGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLNLAECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFTQ
FT                   R"
XX
SQ   Sequence 672 BP; 194 A; 121 C; 172 G; 185 T; 0 other;

hq012424 Length: 672  16-JAN-2011  Type: N  Check: 2699  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggtgatgat gttgttgctg ccgagtcttc tttcggttcc gtaaacttac
     101  acatcgatcc gactttgata acgatgaacg atgtgcgtca gttgggcacc
     151  caacagaacg ctgctttgaa cagagacttg ttccttactt tgaaagggaa
     201  gtatcctaac ttacctgata aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcagttaag agttcatcat tacaaagtga tgacgacgcc
     301  acgggtataa cgtacactcg ggggggtgtt gaagtggatt tgtctgataa
     351  actttggact gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  acgcccttcg agtttggggt agaactaacg atgcccttta cttagctttt
     451  tgcagacaga atcgtaattt gagttatggc ggacgtccgc tagacgcagg
     501  gattccggcc gggtatcatt acttgtgtgc ggatttcttg actggagctg
     551  gtttgaactt agcagaatgt gctgtgtaca tacaagctaa agaacaatta
     601  ttgaagaagc gaggggctga tgaagtcgta gttactaatg tcaggcagct
     651  tgggaaattc acacaacgtt ga