Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate AMT37 coat protein gene, complete cds.

ACC No: HQ012425

Dated: 2011-01-16 | Length: 672 | CRC: -538557619

                
ID   HQ012425; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   HQ012425;
XX
DT   16-JAN-2011 (Rel. 107, Created)
DT   16-JAN-2011 (Rel. 107, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate AMT37 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Ayazpour K., Sijam K., Vadamalai G., Jaafar H.;
RT   ;
RL   Submitted (03-AUG-2010) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Protection, Faculty of Agriculture, University Putra
RL   Malaysia, Upm Darul Ehsan, Serdang, Selangor 43400, Malaysia
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus aurantifolia"
FT                   /isolate="AMT37"
FT                   /mol_type="genomic RNA"
FT                   /country="Malaysia:Tanjung Karang"
FT                   /collection_date="Feb-2010"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ADV15608.1"
FT                   /translation="MDDETKKLKNKNKEAKEGDDVVAAESSFSSVDLHIDPTLIVMNDV
FT                   RRLSTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDGTGIT
FT                   YTREGVEVDLSDKLWTDVVYNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 198 A; 122 C; 171 G; 181 T; 0 other;

hq012425 Length: 672  16-JAN-2011  Type: N  Check: 560  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aagcgaaaga
      51  aggcgacgat gttgttgcgg ctgagtcttc tttcagttcc gtagacttac
     101  acatcgatcc gactctgata gtgatgaatg atgtgcgtcg gttaagcact
     151  caacagaacg ctgctttgaa cagagattta tttcttactt tgaaagggaa
     201  gtatcctaac ttaccagaca aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcaaagcga tgacgacggc
     301  acgggcataa cttacactcg ggagggtgtt gaagtggatt tgtctgacaa
     351  actttggact gatgttgtgt ataactctaa gggtattggt aaccgaacta
     401  acgcccttcg agtctggggt agaactaacg atgcccttta cttagctttt
     451  tgtagacaga atcgcaattt gagttacggc ggacgtccgt tagacgcggg
     501  aattccggcc ggatatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaaaaagc gaggggctga tgaagtcgta gttactaatg tcagacagct
     651  tgggaaattc aacacacgtt ga