Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate AMT41 coat protein gene, complete cds.

ACC No: HQ012429

Dated: 2011-01-16 | Length: 672 | CRC: 651095863

                
ID   HQ012429; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   HQ012429;
XX
DT   16-JAN-2011 (Rel. 107, Created)
DT   16-JAN-2011 (Rel. 107, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate AMT41 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Ayazpour K., Sijam K., Vadamalai G., Jaafar H.;
RT   ;
RL   Submitted (03-AUG-2010) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Protection, Faculty of Agriculture, University Putra
RL   Malaysia, Upm Darul Ehsan, Serdang, Selangor 43400, Malaysia
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="x Citrofortunella microcarpa"
FT                   /isolate="AMT41"
FT                   /mol_type="genomic RNA"
FT                   /country="Malaysia:Tanjung Karang"
FT                   /collection_date="Feb-2010"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ADV15612.1"
FT                   /translation="MDDETKKLKNKNKETKDDAHVVAAESSFGSVNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHLAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVELSDKLWTDVVFNSKGIGNRTNALRVWGRSNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 198 A; 127 C; 167 G; 180 T; 0 other;

hq012429 Length: 672  16-JAN-2011  Type: N  Check: 2355  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  tgacgcccat gttgttgcag ctgagtcttc tttcggttcc gtaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggtact
     151  caacagaatg ctgctttgaa tagagatttg tttcttacct tgaaagggaa
     201  gtatcctaac ttacccgaca aagataaaga ctttcactta gctatgatgt
     251  tatatcgttt agcagttaag agttcatcat tacaaagcga cgatgatacc
     301  acgggtataa cgtacactcg ggaaggtgtt gaagtggaat tgtctgacaa
     351  actttggaca gacgtcgtgt ttaactctaa gggtatcgga aaccgtacta
     401  acgcccttcg agtctggggt agatctaacg atgcccttta tttggctttt
     451  tgtagacaga accgcaactt gagttatggt ggacgtccgt tagatgcagg
     501  aattccagcc gggtatcact acctgtgtgc ggatttcttg accggagctg
     551  gcttgactga tttagaatgt gcggtgtaca tacaagctaa agagcaatta
     601  ttaaagaagc gaggggctga tgaggtcgta gtcactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga