Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate AMT43 coat protein gene, complete cds.

ACC No: HQ012431

Dated: 2011-01-16 | Length: 672 | CRC: -1039520285

                
ID   HQ012431; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   HQ012431;
XX
DT   16-JAN-2011 (Rel. 107, Created)
DT   16-JAN-2011 (Rel. 107, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate AMT43 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Ayazpour K., Sijam K., Vadamalai G., Jaafar H.;
RT   ;
RL   Submitted (03-AUG-2010) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Protection, Faculty of Agriculture, University Putra
RL   Malaysia, Upm Darul Ehsan, Serdang, Selangor 43400, Malaysia
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus aurantifolia"
FT                   /isolate="AMT43"
FT                   /mol_type="genomic RNA"
FT                   /country="Malaysia:Tanjung Karang"
FT                   /collection_date="Feb-2010"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ADV15614.1"
FT                   /translation="MDGETKKLKNKNKEAKDGDDVVAAESSFSSVDLHIDPTLIVMNDV
FT                   RRLSTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDGTGIT
FT                   YTREGVEVDLSDKLWTDVVYNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFTQ
FT                   R"
XX
SQ   Sequence 672 BP; 196 A; 121 C; 171 G; 184 T; 0 other;

hq012431 Length: 672  16-JAN-2011  Type: N  Check: 2803  ..

       1  atggacggcg aaacaaagaa attgaagaac aaaaacaagg aagcgaaaga
      51  tggcgacgat gttgttgctg ctgagtcttc tttcagttct gtagacttac
     101  acatcgatcc gactttgata gtgatgaatg atgtgcgtcg gttaagcact
     151  caacagaatg ctgctttgaa cagggactta ttccttactt tgaaagggaa
     201  gtatcctaac ttaccagaca aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcaaagcga tgacgacggc
     301  acgggcataa cttacactag ggagggtgtt gaagtggatt tgtctgacaa
     351  actttggact gatgttgtgt ataactctaa gggtattggt aaccgaacta
     401  acgcccttcg agtctggggt agaactaacg atgcccttta cttagctttt
     451  tgtagacaga atcgcaattt gagttacggc ggacgtccat tagacgcggg
     501  aattccggcc gggtatcact atctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaatta
     601  ttgaaaaagc gaggggctga tgaagtcgta gttactaatg tcagacagct
     651  tgggaaattc acccaacgtt ga