Sequence of DPV Carnation mottle virus

Carnation mottle virus isolate Ph coat protein gene, complete cds.

ACC No: HQ117872

Dated: 2011-03-22 | Length: 1047 | CRC: 1430079423

                
ID   HQ117872; SV 1; linear; genomic RNA; STD; VRL; 1047 BP.
XX
AC   HQ117872;
XX
DT   22-MAR-2011 (Rel. 108, Created)
DT   22-MAR-2011 (Rel. 108, Last updated, Version 1)
XX
DE   Carnation mottle virus isolate Ph coat protein gene, complete cds.
XX
KW   .
XX
OS   Carnation mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1047
RA   Zheng Y.-X., Chen C.-C., Jan F.-J.;
RT   "First report of Carnation mottle virus in Phalaenopsis orchids in Taiwan";
RL   Unpublished.
XX
RN   [2]
RP   1-1047
RA   Zheng Y.-X., Chen C.-C., Jan F.-J.;
RT   ;
RL   Submitted (11-AUG-2010) to the EMBL/GenBank/DDBJ databases.
RL   Plant Pathology, National Chung Hsing University, 250 Kuo Kuang Road,
RL   Taichung, Taiwan 402, R.O.C.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1047
FT                   /organism="Carnation mottle virus"
FT                   /host="Phalaenopsis"
FT                   /isolate="Ph"
FT                   /mol_type="genomic RNA"
FT                   /country="Taiwan"
FT                   /db_xref="taxon:11986"
FT   CDS             1. .1047
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ADZ55764.1"
FT                   /translation="MENKGEKIAMNPTVQTLAQKGDKLAVKLVTRGWASLSTNQKRRAE
FT                   MLAGYTPAVLAFTPRRPRMTNPPPRTSRNSPGHAGKSMTMSKTELLSTVKGTTGVIPSF
FT                   EDWVVSPRNVAVFPQLSLLATNFNKYRITALTVKYSLACSFETNGRVALGFNDDASDAP
FT                   PTTKVGFYDLGKHVETAAQTAKDLVIPVDGKTRFIRDSASDDAKLVDFGRIVLSTYGFD
FT                   KADTVVGELFIQYTIVLSDPTKTAKISQASNDKVSDGPTYVVPSVNGNELQLRVVAAGK
FT                   WCIIVRGTVEGGFTKPTLIGPGISGDVDYESARPIAVCELVTQMEGQILKITKTSAEQP
FT                   LQWVVYRM"
XX
SQ   Sequence 1047 BP; 299 A; 248 C; 282 G; 218 T; 0 other;

hq117872 Length: 1047  22-MAR-2011  Type: N  Check: 9267  ..

       1  atggaaaata aaggagaaaa gatcgcgatg aatcccactg tgcaaacatt
      51  ggcgcagaag ggggacaagt tagccgtgaa gttggtgaca agagggtggg
     101  cctctctgag tacgaaccag aagaggagag ctgaaatgct tgctggatac
     151  actccagcgg tcctagcctt cacaccccga cgaccacgaa tgacgaatcc
     201  tcctccaaga accagtagga attcaccagg acacgctgga aagtccatga
     251  cgatgagtaa gaccgaacta ttaagcaccg tcaaaggtac cacaggtgtt
     301  atcccaagct ttgaagactg ggtcgtttcc ccccgaaacg tagccgtctt
     351  ccctcaactc tcgctgctgg cgacgaactt caacaagtac cgcatcactg
     401  cgcttactgt gaagtactca ctcgcgtgca gcttcgagac caatgggagg
     451  gtggctctgg gattcaacga tgacgcttcg gacgcaccac caaccaccaa
     501  ggttggattt tacgatctgg gcaaacatgt ggaaactgct gcacagacag
     551  ctaaggatct agtgatacca gtagacggta aaacccggtt catcagggac
     601  tcggctagtg atgatgccaa actagtcgat tttggacgaa tcgtcttgtc
     651  aacatacggg tttgacaagg ctgatactgt ggtgggcgaa ttgtttatac
     701  agtacacgat cgtgctgagt gacccaacca agacggccaa aatttcacag
     751  gcaagcaacg ataaggtgtc ggacggacca acgtatgtgg tcccttcggt
     801  taatggcaac gagctacaac taagagtggt agccgctggg aaatggtgca
     851  ttatagtgcg gggtacggtt gagggaggct tcaccaaacc cacacttatt
     901  gggccgggaa tcagcggtga tgtggactat gaaagtgcca gacctatcgc
     951  cgtttgtgaa ttggtgacac aaatggaggg ccagatattg aaaatcacca
    1001  aaacctcagc agaacaacca ctccaatggg ttgtttatag gatgtga