Sequence of DPV Grapevine leafroll-associated virus 2

Grapevine leafroll-associated virus 2 isolate ajw coat protein gene, complete cds.

ACC No: HQ162288

Dated: 2010-10-21 | Length: 597 | CRC: -1829069658

                
ID   HQ162288; SV 1; linear; genomic RNA; STD; VRL; 597 BP.
XX
AC   HQ162288;
XX
DT   21-OCT-2010 (Rel. 106, Created)
DT   21-OCT-2010 (Rel. 106, Last updated, Version 1)
XX
DE   Grapevine leafroll-associated virus 2 isolate ajw coat protein gene,
DE   complete cds.
XX
KW   .
XX
OS   Grapevine leafroll-associated virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-597
RA   Hong N., Xu M.X.;
RT   ;
RL   Submitted (19-AUG-2010) to the EMBL/GenBank/DDBJ databases.
RL   National Indoor Conservation Center of Virus-Free Germplasm of Fruit Crops,
RL   Huazhong Agricultural University, Wuhan, Hubei 430070, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .597
FT                   /organism="Grapevine leafroll-associated virus 2"
FT                   /host="Vitis vinifera cv."
FT                   /isolate="ajw"
FT                   /mol_type="genomic RNA"
FT                   /country="China"
FT                   /collection_date="Jan-2008"
FT                   /db_xref="taxon:64003"
FT   CDS             1. .597
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ADO34820.1"
FT                   /translation="MELMSDSNLSNLVITDASSLNGVDKKLLSAEVVKMLVQKGAPNEG
FT                   IEVVFGLLLYALAARTTSPKVQRADSDVIFSNSFGERNVVVTEGDLKKVLDGCAPLTRF
FT                   TNKLRTFGRTFTEAYVDFCIAYKHKLPQLNAAAELGIPAEDSYLAADFLGTCPKLSELQ
FT                   QSRKMFASMYALKTEGGVVNTPVSNLRQLGRREVM"
XX
SQ   Sequence 597 BP; 158 A; 123 C; 162 G; 154 T; 0 other;

hq162288 Length: 597  21-OCT-2010  Type: N  Check: 626  ..

       1  atggagttga tgtccgacag caaccttagc aacctggtga taaccgacgc
      51  ctctagtcta aatggtgtcg acaagaaact tttatctgct gaagttgtga
     101  aaatgttggt gcagaaaggg gctcctaacg agggtataga agtggtgttc
     151  ggtctactcc tttacgcact cgcggcaaga accacgtctc ctaaggttca
     201  gcgcgctgat tcagacgtta tattttcaaa tagtttcgga gagaggaatg
     251  tggtagtgac agagggtgac cttaagaagg tgctcgacgg gtgtgcgcct
     301  ctcactaggt tcactaataa acttagaacg ttcggtcgca ctttcactga
     351  ggcttacgtt gacttttgta tcgcgtataa gcacaagtta ccccaactca
     401  acgccgcggc ggaattgggg atcccagctg aagattcgta cttagctgca
     451  gattttctgg gtacttgccc gaagctctct gaattgcagc aaagtaggaa
     501  gatgttcgcg agtatgtacg ctctaaaaac tgaaggtgga gtggtaaata
     551  caccagtgag caatctgcgt cagctgggta gaagggaagt tatgtaa