Sequence of DPV Grapevine leafroll-associated virus 2

Grapevine leafroll-associated virus 2 isolate db coat protein gene, complete cds.

ACC No: HQ162292

Dated: 2010-10-21 | Length: 597 | CRC: 486219472

                
ID   HQ162292; SV 1; linear; genomic RNA; STD; VRL; 597 BP.
XX
AC   HQ162292;
XX
DT   21-OCT-2010 (Rel. 106, Created)
DT   21-OCT-2010 (Rel. 106, Last updated, Version 1)
XX
DE   Grapevine leafroll-associated virus 2 isolate db coat protein gene,
DE   complete cds.
XX
KW   .
XX
OS   Grapevine leafroll-associated virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-597
RA   Hong N., Xu M.X.;
RT   ;
RL   Submitted (19-AUG-2010) to the EMBL/GenBank/DDBJ databases.
RL   National Indoor Conservation Center of Virus-Free Germplasm of Fruit Crops,
RL   Huazhong Agricultural University, Wuhan, Hubei 430070, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .597
FT                   /organism="Grapevine leafroll-associated virus 2"
FT                   /host="Vitis vinifera cv."
FT                   /isolate="db"
FT                   /mol_type="genomic RNA"
FT                   /country="China"
FT                   /collection_date="Dec-2006"
FT                   /db_xref="taxon:64003"
FT   CDS             1. .597
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ADO34824.1"
FT                   /translation="MELMSDSNLSNLVITDASSLNGVDKKLLSAEVVKMLVQKGAPNEG
FT                   IEVVFGLLLYALAARTTSPKVQRADSDVIFSNSFGERNVVVTEGDLKKVLDGCAPLTRF
FT                   TNKLRTFGRTFTEAYVDFCIAYKHKLPQLNAAAELGIPAEDSYLAADFLGTCPKLSELQ
FT                   QSRKMFASMYALKTEGGVVNTPVSNLRQLGRREVM"
XX
SQ   Sequence 597 BP; 164 A; 122 C; 157 G; 154 T; 0 other;

hq162292 Length: 597  21-OCT-2010  Type: N  Check: 9642  ..

       1  atggagttga tgtccgacag caaccttagc aacctggtga taaccgacgc
      51  ctctagtcta aatggtgtcg acaagaagct tttatctgct gaagttgtaa
     101  aaatgttggt gcagaaaggg gctcctaacg agggtataga agtggtgttc
     151  ggtctactcc tttacgcact cgcggcaaga accacgtctc ctaaggttca
     201  gcgcgcagat tcagacgtta tattttcaaa tagtttcgga gagaggaatg
     251  tggtagtaac agagggtgac cttaagaagg tactcgacgg gtgtgcgcct
     301  ctcactaggt tcactaataa acttagaacg ttcggtcgta ctttcactga
     351  ggcttacgtt gacttttgta tcgcgtataa gcacaaatta ccccaactca
     401  acgccgcggc ggaattgggg attccagccg aagattcgta cttagctgca
     451  gattttctgg gtacttgccc gaagctctct gaattacagc aaagtaggaa
     501  gatgttcgcg agtatgtacg ctctaaaaac tgaaggtgga gtggtaaata
     551  caccagtgag caatctgcgt cagctaggta gaagggaagt tatgtaa