Sequence of DPV Penaeus vannamei nodavirus

Penaeus vannamei nodavirus strain Belize segment RNA1 RNA-dependent RNA polymerase and B2-like protein genes, complete cds.

ACC No: HQ259079

Dated: 2011-01-26 | Length: 3111 | CRC: -952835497

                
ID   HQ259079; SV 1; linear; genomic RNA; STD; VRL; 3111 BP.
XX
AC   HQ259079;
XX
DT   26-JAN-2011 (Rel. 107, Created)
DT   26-JAN-2011 (Rel. 107, Last updated, Version 1)
XX
DE   Penaeus vannamei nodavirus strain Belize segment RNA1 RNA-dependent RNA
DE   polymerase and B2-like protein genes, complete cds.
XX
KW   .
XX
OS   Penaeus vannamei nodavirus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Nodaviridae;
OC   unclassified Nodaviridae.
XX
RN   [1]
RP   1-3111
RA   Tang K., Pantoja C., Redman R., Navarro S., Lightner D.;
RT   "Ultrastructural and sequence characterization of Penaeus vannamei
RT   nodavirus (PvNV) from Belize";
RL   Dis. Aquat. Org. 0:0-0(2011).
XX
RN   [2]
RP   1-3111
RA   Tang K.F.J., Navarro S.A., Lightner D.V.;
RT   ;
RL   Submitted (14-SEP-2010) to the EMBL/GenBank/DDBJ databases.
RL   Veterinary Science and Microbiology, University of Arizona, 1117, East
RL   Lowell Street, Tucson, AZ 85721, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3111
FT                   /organism="Penaeus vannamei nodavirus"
FT                   /segment="RNA1"
FT                   /host="Penaeus vannamei"
FT                   /strain="Belize"
FT                   /mol_type="genomic RNA"
FT                   /country="Belize"
FT                   /collection_date="2005"
FT                   /db_xref="taxon:430911"
FT   CDS             7. .3108
FT                   /codon_start=1
FT                   /product="RNA-dependent RNA polymerase"
FT                   /protein_id="ADV74764.1"
FT                   /translation="MKCNNLLLGVELPVCLQSRLGMVLVTGIAMVYLLLYIVTYAVIHG
FT                   PRVSRRLVSYVVIGPYEAITTSRPAMALQRAMVDMTRRDIRSDWYPLQSLLDIKPFRIN
FT                   DNGHKVSGAVRDSARNLITNAVSAMGFDKYEVSPGGHTVDEQFASHRHYAVNDLHRSSG
FT                   DDPIRENNVLVFIDNDYYLREPSMYFSNPNPFILFTFQPITVAGYDGDVRYTISNNEVD
FT                   YRVDGGDRWHHKVWNWCDYGEFICFPMKPRWFTFDWLISCLGVQKVTYQKIHHSRPWVD
FT                   CPNRALVWGVPQFTSYIISWLPMELHARNLTRINYQCGARPGWNCLVDHTKGKLTASIG
FT                   REGNDSHVEISKEDLDIVLGLSTQQSVTSRLIAMGYKQPQTLALVCQFYSGNANSTLDS
FT                   HIVARPSQPPVHWPIASEIDIPTTSFRNYSNPVVCCSNLCPQLKRWEVLSNSLEHRVTM
FT                   VNNTKVPNVRIARLAEEFVRLVVPENGVGVPYSLEETREQLDKPTQVNAINQIWETEDV
FT                   EVRRLIEAFVKNEPTNKPGRIISSFYDPRFLLKFSSYTLAFRDQVLHAEHNSHWFCPGK
FT                   TPSELADKVCEYIQSIGTPAEGDFSNFDGRVSQWCQEHVMNAVYHRWFNKMFTTDLRNY
FT                   TSMLVSCPARAKRFGFQYEPGVGVKSGSPTTCDLNSVLNNFTQYAAIRITKRDLSPSEA
FT                   FQLTGLSFGDDSMFDAQYQRAWNYVVDQLGMELKIEPFDLSKGITFLARVFPDPYSTNT
FT                   SFQDPMRTWRKLHMSARVGVPVESAALDRVSGYLVTDKYSPVTSEYCKMIERCYMPTGE
FT                   DIVRRRQRKDCDRKKPYWMVSGGAWPQAEGDYELMLRVTATRTGFEVPVLINKINEFRN
FT                   VHDPWDITPLDYEEPSPYKHTLDCDGQPVDAVDQRQYQDERKSVNLRACEAAPPGSGAG
FT                   DSGGGQGDQQPASMPGPSGHKRPRQLQRVSGKTGDNLLQGDRQPAVKTKGRRRPKRGDR
FT                   DPRDGGRPGNGQTTNTRAQPARGGNGKARTPGNSSRSRPHLVVS"
FT   CDS             2708. .3103
FT                   /codon_start=1
FT                   /product="B2-like protein"
FT                   /protein_id="ADV74765.1"
FT                   /translation="MQWTNVNIKMNANQSTYELVKQLPQDLGQVIQVVVRAINSLPACQ
FT                   DPRVIKDLDNYKGCLAKLETTCFRATDSLLSKPRVAAALKGEIVTPGMEDALGTAKQQI
FT                   LELSRLVEAMERPELPAIPPVADLISW"
XX
SQ   Sequence 3111 BP; 810 A; 688 C; 757 G; 856 T; 0 other;

hq259079 Length: 3111  26-JAN-2011  Type: N  Check: 6762  ..

       1  ctcgtgatga agtgtaataa tcttctcctc ggtgtggaac tacccgtgtg
      51  cttgcaatcg cgcttgggca tggtgttagt taccggaatc gccatggttt
     101  acttgttgct gtacattgta acgtacgccg taatccatgg acctcgagtc
     151  agccgaagat tagtctccta tgtggtgatt ggaccatatg aggctatcac
     201  gacaagccga cccgccatgg ccttgcaaag ggccatggtt gatatgacca
     251  gaagggacat tcgttctgat tggtatccat tgcaatccct actagatatt
     301  aaacctttta gaatcaacga caatggacat aaggtttctg gtgctgttag
     351  ggattctgct agaaatttaa taactaatgc agttagtgca atgggttttg
     401  acaagtatga agtctcacct ggtggccata ccgtcgatga acagtttgca
     451  agtcatcgac attatgccgt taacgattta catcgaagta gtggtgacga
     501  tccgattaga gagaacaacg tgttggtatt catagataat gactactatt
     551  tacgtgaacc gtcgatgtat ttctcaaatc ccaacccatt catattgttt
     601  acctttcaac ccatcacagt tgctggctat gatggtgatg ttagatatac
     651  catctctaac aatgaggtag actatcgtgt ggatggtgga gatcgttggc
     701  atcataaggt gtggaactgg tgtgattatg gggagttcat ctgtttcccc
     751  atgaagccaa ggtggtttac ttttgattgg ctaattagct gccttggtgt
     801  tcagaaagtc acctatcaga agattcacca ttcacgtccc tgggtggatt
     851  gccctaacag ggctttggtt tggggagtac cacagtttac tagttacata
     901  atttcctggc tacctatgga gttacatgca aggaatttaa ctagaattaa
     951  ttatcaatgt ggtgctcgtc ctggttggaa ttgccttgtt gatcatacta
    1001  agggcaaact cactgcgagt attggtcgtg agggcaacga ctctcatgtt
    1051  gagatttcca aggaggatct tgacattgtc ctcgggctta gtactcaaca
    1101  gtctgttaca tccagactta ttgcaatggg ttataaacaa ccacaaacct
    1151  tagccttggt gtgtcagttc tacagtggta atgccaatag tacattggat
    1201  tcacacattg tagcccgacc atctcaacca cccgtccact ggccaatagc
    1251  atccgagatc gatattccga caacgtcctt caggaactac tccaaccctg
    1301  ttgtgtgttg cagtaatctt tgtccccaac taaagcgttg ggaggtcctt
    1351  agcaactcgc tagagcacag ggttacgatg gttaataata ccaaggtacc
    1401  aaatgttcgc atcgctcgac tagctgaaga atttgtaagg ttagttgtgc
    1451  ccgaaaatgg tgtgggtgta ccttatagtc ttgaagagac gcgcgaacaa
    1501  ctggataagc caacgcaagt caatgctatc aatcaaatct gggaaacgga
    1551  ggacgttgag gttcgcaggt tgattgaggc atttgttaag aatgaaccaa
    1601  ctaataagcc tgggcgtata atatcttcat tttatgatcc taggtttttg
    1651  ttgaagtttt cttcttatac acttgctttc cgggatcaag ttcttcatgc
    1701  tgaacacaat agccactggt tttgccctgg gaaaacaccc tctgagctag
    1751  ccgataaagt atgcgagtat attcagtcca ttggaacccc agctgaaggt
    1801  gatttcagta attttgatgg tcgtgtatca caatggtgcc aggagcacgt
    1851  gatgaatgcg gtctatcata ggtggttcaa taagatgttt acgactgacc
    1901  ttcgcaatta tacctccatg ttggttagct gtcctgctag agcaaaacgc
    1951  tttggttttc agtatgaacc cggagttggc gttaagagtg gtagtcctac
    2001  aacttgtgac ttaaactctg ttcttaataa ctttacccag tacgcggcca
    2051  ttcggattac aaagcgcgat ctatctcctt ctgaagcctt ccagctgacc
    2101  ggacttagtt tcggtgatga ttcaatgttc gatgctcaat atcaacgagc
    2151  ttggaactac gtggttgatc agcttggaat ggaacttaag attgagccgt
    2201  ttgacctcag taaaggtatc actttccttg cgcgcgtatt tcctgatcct
    2251  tattctacca atacgagttt tcaggatcca atgcggacat ggcgaaagtt
    2301  gcacatgtcc gcgcgcgttg gtgttcctgt cgaatcagca gctcttgatc
    2351  gtgttagtgg ctacttagtt actgacaagt attccccagt caccagtgaa
    2401  tactgtaaga tgattgagag gtgctatatg cctacaggtg aagacatcgt
    2451  tcgaagacgc caacgtaagg attgtgaccg aaagaaacct tactggatgg
    2501  ttagcggggg tgcttggccc caggctgagg gcgattatga attgatgtta
    2551  cgcgtgacgg cgacgcgaac tggtttcgaa gttcctgtgt taattaataa
    2601  gatcaacgaa tttcgaaacg ttcatgaccc ctgggacatc actcctcttg
    2651  attatgagga gccatcaccc tacaaacata ctttggattg tgatggacaa
    2701  ccagttgatg cagtggacca acgtcaatat caagatgaac gcaaatcagt
    2751  caacctacga gcttgtgaag cagctccccc aggatctggg gcaggtgatt
    2801  caggtggtgg tcagggcgat caacagcctg ccagcatgcc aggaccctcg
    2851  ggtcataaaa gacctcgaca actacaaagg gtgtctggca aaactggaga
    2901  caacctgctt cagggcgacc gacagcctgc tgtcaaaacc aagggtcgcc
    2951  gccgccctaa aaggggagat cgtgacccca gggatggagg acgccctggg
    3001  aacggccaaa caacaaatac tcgagctcag ccggctcgtg gaggcaatgg
    3051  aaaggccaga actcccggca attcctcccg tagccgacct catctcgtgg
    3101  taagctagcc g