Sequence of DPV Picobiliphyte nanovirus

Picobiliphyte sp. MS584-5 nanovirus, complete genome.

ACC No: HQ322117

Dated: 2011-06-22 | Length: 1832 | CRC: -212311455

                
ID   HQ322117; SV 1; circular; genomic DNA; STD; VRL; 1832 BP.
XX
AC   HQ322117;
XX
DT   22-JUN-2011 (Rel. 109, Created)
DT   22-JUN-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Picobiliphyte sp. MS584-5 nanovirus, complete genome.
XX
KW   .
XX
OS   Picobiliphyte sp. MS584-5 nanovirus
OC   Viruses; ssDNA viruses; Nanoviridae; Nanovirus; unclassified Nanovirus.
XX
RN   [1]
RP   1-1832
RX   PUBMED; 21551060.
RA   Yoon H.S., Price D.C., Stepanauskas R., Rajah V.D., Sieracki M.E.,
RA   Wilson W.H., Yang E.C., Duffy S., Bhattacharya D.;
RT   "Single-cell genomics reveals organismal interactions in uncultivated
RT   marine protists";
RL   Science 332(6030):714-717(2011).
XX
RN   [2]
RP   1-1832
RA   Bhattacharya D., Yoon H.S., Price D.C., Stepanauskas R., Sieracki M.E.,
RA   Wilson W.H., Yang E.C., Duffy S.;
RT   ;
RL   Submitted (28-SEP-2010) to the INSDC.
RL   Ecology, Evolution & Natural Resources, Rutgers University, 59 Dudley Road,
RL   New Brunswick, NJ 08901, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1832
FT                   /organism="Picobiliphyte sp. MS584-5 nanovirus"
FT                   /isolate="MS584-5"
FT                   /mol_type="genomic DNA"
FT                   /country="USA:off coast of Maine"
FT                   /isolation_source="Picobiliphyte single cell from seawater"
FT                   /db_xref="taxon:1046893"
FT   CDS             1020. .1832
FT                   /codon_start=1
FT                   /product="rep protein"
FT                   /note="putative viral replication protein"
FT                   /protein_id="AEI54346.1"
FT                   /translation="MDDDRANRAEESGEGNTVLSPPKQGTQHTFWCFTLNNYTAEQIEH
FT                   LELVFKHECKWYLFQEEVGEKCGTPHLQGQICLKTRMRMTELKRIDMKISWRATKSCTA
FT                   SLEYCKKKETSTGKIYYHGMDVPDQVDLEEPYGWQLDILNVLKDKPHNRIIHWYWEPTG
FT                   GKGKTSLSKYLVVKHDALMLTGKSNDMYHMISKFPKKRKLFIVDCPRSQQDYINYGAIE
FT                   QIKNGLIFSGKYEGAQLVFNAPHVIVFANEPPDISKMSLDRWNVVRIA"
XX
SQ   Sequence 1832 BP; 574 A; 316 C; 416 G; 526 T; 0 other;

hq322117 Length: 1832  22-JUN-2011  Type: N  Check: 9868  ..

       1  aggcatttct attccaccta cgccgaataa gagttgtaac ccctaaaggg
      51  gtaagaattc gagcgacgca cgatgaaaac ctcaacatca aagatgtctc
     101  gctttccatt cggcggacgg tgggcagctg aagctgcgtt attaaaaata
     151  gtgttattat tttgcgttat taaaaatagt gttattattt ttcttaatta
     201  tccttgaaga atagctcagt attcagggat attttagcaa ggttgaatgt
     251  tgtatcagca tcagggtgag cactgaaagc acaagcatga acacaatagt
     301  tatacgattt accatcgttg gtggtgttat tctcatactg gtaggattta
     351  atcctgccca ttggaatata cattatttta gttctaaatt caggtgttac
     401  atctacagaa gatgaagcat tccatgtact gaattcattt ttgagattaa
     451  tagagaacga ccgaaccaca gtgtgtgttc gtctttcaac tggggccatc
     501  atactgttag aattgatgta tcgtaggaag tcgttagaga tattcacatt
     551  agagtggtgt gtgcgtaaga cccacacctt tacccagata tttccgttta
     601  acatatttat tccagcagca ggttggtcct gttgacattg aatatagagt
     651  ttaatcccta caggttgaat agagttacct atacggttac cagaggttgc
     701  tcctgaatca ataccttgac ttgttacgag taattgagat gctatcaact
     751  tgggtacatt atgatagata actacggggt tgggggtaaa agattggatt
     801  cgagacttgg tctcggtgtt agcgttgagg actcttttag caatgttata
     851  catgctccga gaagacggtt tacgagtgta agtacgcttc ttatacggtt
     901  tacgcaccgt gcgagtggat ttacgaacat agggcatttt attatagtat
     951  tataaatagt ctttaaatag atatcatcct taaaggtatt taaggataac
    1001  gctactaata tgcctaaaga tggacgacga tagagcaaat agagcagaag
    1051  agagcgggga gggtaatact gtactctccc cgccaaaaca agggactcag
    1101  cacacattct ggtgcttcac ccttaataac tacacagcag agcaaataga
    1151  gcacttagag cttgtattca agcacgagtg caaatggtac ctcttccagg
    1201  aggaagtagg tgagaagtgt ggtacaccac atttacaagg tcaaatatgt
    1251  cttaagactc gtatgaggat gaccgagctg aagcgcatag acatgaagat
    1301  aagctggaga gcgactaagt cgtgtacagc atctctggaa tattgtaaga
    1351  agaaggagac cagtactggt aagatatatt atcatggaat ggatgtgcct
    1401  gaccaggtag acctggagga accttatggc tggcaactgg acattctaaa
    1451  tgtacttaag gataagccac ataatagaat tatacattgg tactgggaac
    1501  ctaccggcgg taaggggaag acatcattaa gcaaatacct cgtggtgaaa
    1551  cacgatgcct taatgttgac tggaaaaagt aatgatatgt accatatgat
    1601  atcaaagttc ccaaagaaga gaaaattatt cattgtggac tgtcctcgtt
    1651  cacagcaaga ttatatcaat tacggagcaa ttgaacaaat taaaaatggt
    1701  ctgatattct caggtaagta tgaaggggct caattagtat ttaatgcacc
    1751  tcatgttatc gtatttgcta atgaaccgcc agatatatct aagatgagtc
    1801  ttgataggtg gaatgtggtc cgtatagcct aa