Sequence of DPV Citrus tristeza virus

Citrus tristeza virus clone 180 P18 gene, complete cds.

ACC No: HQ329209

Dated: 2010-12-29 | Length: 504 | CRC: 881157615

                
ID   HQ329209; SV 1; linear; genomic RNA; STD; VRL; 504 BP.
XX
AC   HQ329209;
XX
DT   29-DEC-2010 (Rel. 107, Created)
DT   29-DEC-2010 (Rel. 107, Last updated, Version 1)
XX
DE   Citrus tristeza virus clone 180 P18 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-504
RA   Atta S.;
RT   "citrus tristeza virus from Pakistan";
RL   Unpublished.
XX
RN   [2]
RP   1-504
RA   Atta S.;
RT   ;
RL   Submitted (30-SEP-2010) to the EMBL/GenBank/DDBJ databases.
RL   Sequencing Lab, Shanghai Biosune Biotechnology Co. Ltd., Donglan Road No.
RL   248, 5th floor, Shanghai 201102, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .504
FT                   /organism="Citrus tristeza virus"
FT                   /host="Feutrell's Early"
FT                   /mol_type="genomic RNA"
FT                   /country="Pakistan"
FT                   /collection_date="2008"
FT                   /clone="180"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .504
FT                   /codon_start=1
FT                   /product="P18"
FT                   /protein_id="ADU02539.1"
FT                   /translation="MSGSLGNLTHVDLLRSDSRSLSGWWSFIVNVGDIIVRFALHVPNE
FT                   DMLNSFSAISNCTIIADGSALLKDNTVVDRLEGMNPLAYLLNLAKTTTTICFTMSNKVL
FT                   FGTTKSEPLSCLAIASDRVLFKVIMGTNVDDSRCGCSIWFYDNGTFQNGLIRCNNLVTL
FT                   FSVT"
XX
SQ   Sequence 504 BP; 127 A; 85 C; 113 G; 179 T; 0 other;

hq329209 Length: 504  29-DEC-2010  Type: N  Check: 7988  ..

       1  atgtcaggca gcttgggaaa tttaacacac gttgatctat tgcgttctga
      51  ttcccggtct ctatcgggat ggtggagttt catcgtgaac gtgggtgata
     101  taatagtccg gtttgcgtta cacgttccta atgaagatat gctgaatagc
     151  ttttcagcta tatcgaattg tacgatcata gcggacggta gtgctttatt
     201  aaaagacaat accgtggttg atcgtttaga aggcatgaat cctttggctt
     251  atttgttaaa tttagcgaaa acgactacta ctatttgttt tactatgtct
     301  aataaggttc tttttggtac tactaaatcc gaaccactta gttgtttagc
     351  tatcgcgtca gatcgagttt tgttcaaagt tattatgggt actaacgttg
     401  acgattctcg atgcggctgc agtatttggt tttacgacaa tggtacgttt
     451  caaaacggat tgatccgttg taataatctc gtcactttgt ttagcgtgac
     501  ttag