Sequence of DPV Citrus tristeza virus

Citrus tristeza virus clone 183 P18 gene, complete cds.

ACC No: HQ329210

Dated: 2010-12-29 | Length: 504 | CRC: 381451685

                
ID   HQ329210; SV 1; linear; genomic RNA; STD; VRL; 504 BP.
XX
AC   HQ329210;
XX
DT   29-DEC-2010 (Rel. 107, Created)
DT   29-DEC-2010 (Rel. 107, Last updated, Version 1)
XX
DE   Citrus tristeza virus clone 183 P18 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-504
RA   Atta S.;
RT   "citrus tristeza virus from Pakistan";
RL   Unpublished.
XX
RN   [2]
RP   1-504
RA   Atta S.;
RT   ;
RL   Submitted (30-SEP-2010) to the EMBL/GenBank/DDBJ databases.
RL   Sequencing Lab, Shanghai Biosune Biotechnology Co. Ltd., Donglan Road No.
RL   248, 5th floor, Shanghai 201102, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .504
FT                   /organism="Citrus tristeza virus"
FT                   /host="Feutrell's Early"
FT                   /mol_type="genomic RNA"
FT                   /country="Pakistan"
FT                   /collection_date="2008"
FT                   /clone="183"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .504
FT                   /codon_start=1
FT                   /product="P18"
FT                   /protein_id="ADU02540.1"
FT                   /translation="MSGSLGNLTHVDLLRSDSRFISGWWSFIVNVGDIIVRFALHVPSE
FT                   DVLNSFSAISNCTIIADGSALLKDNTIVDRLEGMNPLAYLLKLAKTTTTICFTMSNKVL
FT                   FGTTKSEPLSCLAITSDRVLFKVVMGTNVDDSRCGCSIWFYNNGTFQNGLTRCNNLVAL
FT                   FSVT"
XX
SQ   Sequence 504 BP; 126 A; 88 C; 114 G; 176 T; 0 other;

hq329210 Length: 504  29-DEC-2010  Type: N  Check: 5296  ..

       1  atgtcaggca gcttgggaaa tttaacacac gttgatctat tgcgttctga
      51  ttcccggttt atatcgggat ggtggagttt cattgttaac gtgggtgaca
     101  taatcgtccg gtttgcgtta catgttccta gtgaagatgt gctgaatagt
     151  ttttcggcta tatcgaattg cacaatcata gcagacggta gtgccttact
     201  aaaagacaac accatcgttg accgtttgga aggcatgaat cctttggctt
     251  atttgttaaa attagcgaaa acgactacta ctatttgttt tactatgtct
     301  aataaggttc tttttggtac tactaaatcc gaaccactta gttgtttagc
     351  tatcacatcg gatcgagttt tattcaaagt tgttatgggt actaatgttg
     401  atgattctcg gtgcggctgc agtatttggt tttacaacaa tgggacgttt
     451  caaaacgggt tgacccgttg taacaatctc gtcgctttgt ttagcgtgac
     501  ttag