Sequence of DPV Citrus tristeza virus

Citrus tristeza virus clone 231 P18 gene, complete cds.

ACC No: HQ329212

Dated: 2010-12-29 | Length: 504 | CRC: -1394652444

                
ID   HQ329212; SV 1; linear; genomic RNA; STD; VRL; 504 BP.
XX
AC   HQ329212;
XX
DT   29-DEC-2010 (Rel. 107, Created)
DT   29-DEC-2010 (Rel. 107, Last updated, Version 1)
XX
DE   Citrus tristeza virus clone 231 P18 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-504
RA   Atta S.;
RT   "citrus tristeza virus from Pakistan";
RL   Unpublished.
XX
RN   [2]
RP   1-504
RA   Atta S.;
RT   ;
RL   Submitted (30-SEP-2010) to the EMBL/GenBank/DDBJ databases.
RL   Sequencing Lab, Shanghai Biosune Biotechnology Co. Ltd., Donglan Road No.
RL   248, 5th floor, Shanghai 201102, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .504
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus reticulata"
FT                   /mol_type="genomic RNA"
FT                   /country="Pakistan"
FT                   /collection_date="2008"
FT                   /clone="231"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .504
FT                   /codon_start=1
FT                   /product="P18"
FT                   /protein_id="ADU02542.1"
FT                   /translation="MSGSLGNLTHVDLLRSDSRFLSGWWSFIVNVGDIIVRFALHVPSE
FT                   DMLNSFSAISNCTIIADGSALLKDNTVVDRLESMNPLAYLLKLAKTTTTICFTMSNKVL
FT                   FGTTKSEPLSCLAITSDRVLFKVIMGTNVDDSRRGCSIWFYNNGVFQNGLTRCNNLVAL
FT                   FSVT"
XX
SQ   Sequence 504 BP; 123 A; 86 C; 118 G; 177 T; 0 other;

hq329212 Length: 504  29-DEC-2010  Type: N  Check: 8327  ..

       1  atgtcaggca gcttgggaaa tttaacacac gttgatctat tgcgttctga
      51  ttcccggttt ctatcgggat ggtggagttt catcgtgaac gtgggtgata
     101  taatcgttcg gtttgcgtta cacgttccta gtgaagatat gctgaatagc
     151  ttttcagcta tatcgaattg tacgatcata gcggacggta gtgctttact
     201  aaaagacaac actgtggttg accgtttaga gagcatgaac cctttggctt
     251  atttgttaaa gttagcgaaa acgactacta ctatttgttt tactatgtct
     301  aataaggttc tttttggtac tactaaatcc gaaccgctta gttgtttagc
     351  tatcacgtcg gaccgagttt tattcaaagt tattatgggt actaacgttg
     401  atgattctcg acgtggctgc agtatttggt tttacaacaa tggggtgttt
     451  caaaatgggt tgacccgttg taataatctc gtcgctttgt ttagcgtgac
     501  ttag