Sequence of DPV Citrus tristeza virus

Citrus tristeza virus clone 242 P18 gene, complete cds.

ACC No: HQ329213

Dated: 2010-12-29 | Length: 504 | CRC: 895545776

                
ID   HQ329213; SV 1; linear; genomic RNA; STD; VRL; 504 BP.
XX
AC   HQ329213;
XX
DT   29-DEC-2010 (Rel. 107, Created)
DT   29-DEC-2010 (Rel. 107, Last updated, Version 1)
XX
DE   Citrus tristeza virus clone 242 P18 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-504
RA   Atta S.;
RT   "citrus tristeza virus from Pakistan";
RL   Unpublished.
XX
RN   [2]
RP   1-504
RA   Atta S.;
RT   ;
RL   Submitted (30-SEP-2010) to the EMBL/GenBank/DDBJ databases.
RL   Sequencing Lab, Shanghai Biosune Biotechnology Co. Ltd., Donglan Road No.
RL   248, 5th floor, Shanghai 201102, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .504
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus reticulata"
FT                   /mol_type="genomic RNA"
FT                   /country="Pakistan"
FT                   /collection_date="2008"
FT                   /clone="242"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .504
FT                   /codon_start=1
FT                   /product="P18"
FT                   /protein_id="ADU02543.1"
FT                   /translation="MSGSLGNLTHVDLLRSESRFISGWWSFVVNVGDIIVRFALHVPSE
FT                   EMLNDFSAISNCTIIADGSALLKDNTVVDRLEGMNPLAYLLKLAKTTTTICFTMSNKVL
FT                   FGTTKSEPLSCLAITSDRVLFKVVMGTNVDDTRCGCSIWFYNNGMFRNGLTRCDNLVTL
FT                   FSVT"
XX
SQ   Sequence 504 BP; 133 A; 88 C; 112 G; 171 T; 0 other;

hq329213 Length: 504  29-DEC-2010  Type: N  Check: 4059  ..

       1  atgtcaggca gcttgggaaa tttaacacac gttgatttat tgcgttctga
      51  atctcgattc atatcgggat ggtggagttt cgtcgtgaac gtaggcgata
     101  taatcgtccg gtttgcgtta cacgttccta gcgaagaaat gctgaatgat
     151  ttttcagcta tatcgaattg cacaatcata gcggacggta gtgctttact
     201  aaaagacaac accgtagttg atcgtttaga aggcatgaac cccttggctt
     251  atttgttaaa attagcaaaa acgactacta ctatttgttt cactatgtct
     301  aataaggttc tttttggtac tactaaatcc gaaccgctta gttgtttagc
     351  tattacgtcg gatcgagttt tattcaaagt tgttatgggt actaacgttg
     401  atgatactcg atgcggttgc agtatctggt tttacaacaa tggaatgttt
     451  cgaaacggat tgacccgttg tgataatctc gtcactttgt ttagcgtgac
     501  ttag