Sequence of DPV Citrus tristeza virus

Citrus tristeza virus clone 143 P20 gene, complete cds.

ACC No: HQ329221

Dated: 2010-12-29 | Length: 549 | CRC: 361705133

                
ID   HQ329221; SV 1; linear; genomic RNA; STD; VRL; 549 BP.
XX
AC   HQ329221;
XX
DT   29-DEC-2010 (Rel. 107, Created)
DT   29-DEC-2010 (Rel. 107, Last updated, Version 1)
XX
DE   Citrus tristeza virus clone 143 P20 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-549
RA   Atta S.;
RT   "citrus tristeza virus from Pakistan";
RL   Unpublished.
XX
RN   [2]
RP   1-549
RA   Atta S.;
RT   ;
RL   Submitted (30-SEP-2010) to the EMBL/GenBank/DDBJ databases.
RL   Sequencing Lab, Shanghai Biosune Biotechnology Co. Ltd., Donglan Road No.
RL   248, 5th floor, Shanghai 201102, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .549
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus sinensis"
FT                   /mol_type="genomic RNA"
FT                   /country="Pakistan"
FT                   /collection_date="2008"
FT                   /clone="143"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .549
FT                   /codon_start=1
FT                   /product="P20"
FT                   /protein_id="ADU02550.1"
FT                   /translation="MRAYFSVNDYISLLAKVGAVVERLCDPSVTLTEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHQDGHHEMGEHKSRLLCNIEAKLRILLDIIRRRFTRDKLLCTSATD
FT                   VMGFFVMRYMASSHISFESVMRTELKVVVKTVLSDLSRAHKLDFSERAFAAYGILLQKG
FT                   TVATVCGQFDINLVSPSCV"
XX
SQ   Sequence 549 BP; 140 A; 112 C; 135 G; 162 T; 0 other;

hq329221 Length: 549  29-DEC-2010  Type: N  Check: 4538  ..

       1  atgcgagctt actttagtgt taacgattac ataagccttt tggctaaggt
      51  cggcgcagtt gtggaacgtt tgtgcgatcc cagcgtgact ctcacggaag
     101  tgatggacga aattaatgat tttaactcgt ttctcgcttt agtacactct
     151  atgaagtcag atatgaacgg tgatcatcag gatggtcacc atgaaatggg
     201  tgagcacaag tctcgattgt tgtgcaatat agaggcgaag ctgcgaatac
     251  ttctcgacat cataagacgt cggtttactc gcgacaagct gctctgtacc
     301  agcgcaacag acgtcatggg cttcttcgtt atgaggtaca tggcttctag
     351  tcacatcagt tttgaatccg taatgcgaac ggagttgaaa gtagtagtta
     401  aaacagtact atcggattta tcccgcgcgc ataaactaga ttttagcgag
     451  cgagccttcg cggcttacgg tatcctttta caaaagggca ctgtagcgac
     501  cgtttgtggt cagtttgaca ttaatttagt ttctccatct tgcgtgtag