Sequence of DPV Citrus tristeza virus

Citrus tristeza virus clone 188 P20 gene, complete cds.

ACC No: HQ329228

Dated: 2010-12-29 | Length: 549 | CRC: 667800290

                
ID   HQ329228; SV 1; linear; genomic RNA; STD; VRL; 549 BP.
XX
AC   HQ329228;
XX
DT   29-DEC-2010 (Rel. 107, Created)
DT   29-DEC-2010 (Rel. 107, Last updated, Version 1)
XX
DE   Citrus tristeza virus clone 188 P20 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-549
RA   Atta S.;
RT   "citrus tristeza virus from Pakistan";
RL   Unpublished.
XX
RN   [2]
RP   1-549
RA   Atta S.;
RT   ;
RL   Submitted (30-SEP-2010) to the EMBL/GenBank/DDBJ databases.
RL   Sequencing Lab, Shanghai Biosune Biotechnology Co. Ltd., Donglan Road No.
RL   248, 5th floor, Shanghai 201102, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .549
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus reticulata"
FT                   /mol_type="genomic RNA"
FT                   /country="Pakistan"
FT                   /collection_date="2008"
FT                   /clone="188"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .549
FT                   /codon_start=1
FT                   /product="P20"
FT                   /protein_id="ADU02555.1"
FT                   /translation="MRAYFSVNDYISLSAKVGAVVERLCDPSATLTEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHQDGHHEMGEHKSRLLCNIEAKLRILLDIIRRRFTRDKLLCTSATD
FT                   TMGFFVMRYMSSSHTSFESVMRTELKLVVKAVLSDLSRAHKLDFSERAFAAYGILLQKG
FT                   TVAAVCGQFDINLVSPSCV"
XX
SQ   Sequence 549 BP; 140 A; 116 C; 136 G; 157 T; 0 other;

hq329228 Length: 549  29-DEC-2010  Type: N  Check: 1193  ..

       1  atgcgagctt actttagtgt taacgattac ataagccttt cggctaaggt
      51  cggcgcagtt gtggaacgtt tatgcgatcc aagcgcaact ctcacggaag
     101  tgatggacga aattaatgat tttaactcgt ttctcgcttt ggtacactct
     151  atgaagtcgg acatgaacgg cgatcatcag gatggtcacc atgagatggg
     201  tgaacacaag tctcgattgt tgtgcaatat agaggcgaaa ctgcgaatac
     251  ttctcgacat cataagacgt cggtttactc gcgacaagct actctgtacc
     301  agcgcaacag ataccatggg cttcttcgtt atgaggtaca tgagttctag
     351  tcacaccagt ttcgagtccg taatgcgaac ggagctgaaa ttagtggtta
     401  aagcggtact gtcggattta tcccgcgcgc ataaactaga ttttagcgag
     451  cgagcctttg cagcttacgg tatcctttta caaaagggta ctgtagcggc
     501  cgtttgcggt cagtttgaca ttaatttagt ttctccatct tgcgtgtag