Sequence of DPV Citrus tristeza virus

Citrus tristeza virus clone 108 P23 gene, complete cds.

ACC No: HQ329231

Dated: 2010-12-29 | Length: 633 | CRC: -491830180

                
ID   HQ329231; SV 1; linear; genomic RNA; STD; VRL; 633 BP.
XX
AC   HQ329231;
XX
DT   29-DEC-2010 (Rel. 107, Created)
DT   29-DEC-2010 (Rel. 107, Last updated, Version 1)
XX
DE   Citrus tristeza virus clone 108 P23 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-633
RA   Atta S.;
RT   "citrus tristeza virus from Pakistan";
RL   Unpublished.
XX
RN   [2]
RP   1-633
RA   Atta S.;
RT   ;
RL   Submitted (30-SEP-2010) to the EMBL/GenBank/DDBJ databases.
RL   Sequencing Lab, Shanghai Biosune Biotechnology Co. Ltd., Donglan Road No.
RL   248, 5th floor, Shanghai 201102, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .633
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus sinensis"
FT                   /mol_type="genomic RNA"
FT                   /country="Pakistan"
FT                   /collection_date="2008"
FT                   /clone="108"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .630
FT                   /codon_start=1
FT                   /product="P23"
FT                   /protein_id="ADU02558.1"
FT                   /translation="MDNTSGQTFISVSLSDESNTASTEVKTVSSEADRLEFLRKMNPFV
FT                   IDALIRKTSYQGARFRARIIGVCVDCGRKHDKGSRTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLSKRKARAFSNAEMFAIDLVMYTKERQLAVDLAAEREKTRLARKHPMRSPEETPEH
FT                   YKFGMTAKAMLPDINVVNVGDNEDTSSEYPVSLSLRGGVLREHHFI"
XX
SQ   Sequence 633 BP; 192 A; 121 C; 160 G; 160 T; 0 other;

hq329231 Length: 633  29-DEC-2010  Type: N  Check: 1002  ..

       1  atggataata ctagcggaca aactttcatt tccgtgagcc tttctgacga
      51  aagcaacacg gctagtactg aagttaaaac cgtaagttct gaagcggatc
     101  gcttggaatt tttacggaaa atgaatccct ttgttatcga tgctttgata
     151  cggaaaacca gttatcaggg tgctcgcttt cgcgcgagaa taataggagt
     201  gtgcgtggat tgtggtagaa aacacgataa ggggtcgagg actgaacgta
     251  agtgtaaggt caacaataca cagtctcaga acgaggtggc gcatatgtta
     301  atgcacgatc ccgttaagta tttaagtaaa agaaaagcta gagccttttc
     351  taacgcagag atgtttgcga tcgatttggt tatgtacacc aaagaaaggc
     401  agttagcggt tgatttggcc gctgaaaggg aaaagacgag actggctcgt
     451  aaacacccaa tgcgttctcc ggaagaaact ccggaacatt ataaattcgg
     501  tatgactgct aaagcaatgt taccggacat caacgtcgta aacgttggtg
     551  acaacgaaga tacttcgtcg gagtacccag taagtttgag tttacgcggc
     601  ggagttctcc gtgaacacca cttcatctga ttg