Sequence of DPV Citrus tristeza virus

Citrus tristeza virus clone 179 P23 gene, complete cds.

ACC No: HQ329241

Dated: 2010-12-29 | Length: 633 | CRC: 2132122462

                
ID   HQ329241; SV 1; linear; genomic RNA; STD; VRL; 633 BP.
XX
AC   HQ329241;
XX
DT   29-DEC-2010 (Rel. 107, Created)
DT   29-DEC-2010 (Rel. 107, Last updated, Version 1)
XX
DE   Citrus tristeza virus clone 179 P23 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-633
RA   Atta S.;
RT   "citrus tristeza virus from Pakistan";
RL   Unpublished.
XX
RN   [2]
RP   1-633
RA   Atta S.;
RT   ;
RL   Submitted (30-SEP-2010) to the EMBL/GenBank/DDBJ databases.
RL   Sequencing Lab, Shanghai Biosune Biotechnology Co. Ltd., Donglan Road No.
RL   248, 5th floor, Shanghai 201102, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .633
FT                   /organism="Citrus tristeza virus"
FT                   /host="Feutrell's Early"
FT                   /mol_type="genomic RNA"
FT                   /country="Pakistan"
FT                   /collection_date="2008"
FT                   /clone="179"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .630
FT                   /codon_start=1
FT                   /product="P23"
FT                   /protein_id="ADU02568.1"
FT                   /translation="MDNTSGQTFISVNLSDESNTASTEVKTVGSEADRLEFLRKMNPFV
FT                   IDALIRKTSYQGARFRARIIGVCVDCGRKHDKATRTERKCKVNNTQSQAEVAHMLMHDP
FT                   VKYLIKRKARAFSNAEMFAIDLVMHTKERQLAVNLAAEREKTRLARRHPMRSPEETPEH
FT                   YEFGMTAKAMLPDVNAIDVGDNEDTSSEYPVSLSISGGVLREHHFI"
XX
SQ   Sequence 633 BP; 188 A; 124 C; 163 G; 158 T; 0 other;

hq329241 Length: 633  29-DEC-2010  Type: N  Check: 1874  ..

       1  atggataata ctagcggaca aactttcatt tccgtgaacc tttctgatga
      51  aagcaacacg gctagtactg aagttaaaac cgtaggttct gaagcggatc
     101  gcttggaatt tttacggaaa atgaatccct ttgttatcga cgccttgata
     151  cggaaaacca gttatcaggg tgctcgcttt cgcgcgagaa taataggagt
     201  gtgcgtggat tgtggtagaa aacacgataa ggcaacgagg actgagcgta
     251  agtgtaaagt caacaataca caatctcagg ccgaggtggc gcacatgtta
     301  atgcacgatc ccgtgaaata tttaattaaa agaaaagcta gagctttttc
     351  taacgcagag atgtttgcga tcgatttggt tatgcacacc aaagaaagac
     401  aattagcggt taatttggcc gctgaaaggg agaagacgag attggctcgt
     451  agacacccga tgcgttctcc ggaggaaact ccggaacatt atgagttcgg
     501  tatgactgct aaggcaatgt taccggacgt caacgctata gacgttggtg
     551  ataacgagga cacttcgtcg gagtacccag tgagtctgag tatttcaggc
     601  ggagttctcc gtgaacacca cttcatctga ttg