Sequence of DPV Citrus tristeza virus

Citrus tristeza virus clone 188 P23 gene, complete cds.

ACC No: HQ329244

Dated: 2010-12-29 | Length: 633 | CRC: 746770205

                
ID   HQ329244; SV 1; linear; genomic RNA; STD; VRL; 633 BP.
XX
AC   HQ329244;
XX
DT   29-DEC-2010 (Rel. 107, Created)
DT   29-DEC-2010 (Rel. 107, Last updated, Version 1)
XX
DE   Citrus tristeza virus clone 188 P23 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-633
RA   Atta S.;
RT   "citrus tristeza virus from Pakistan";
RL   Unpublished.
XX
RN   [2]
RP   1-633
RA   Atta S.;
RT   ;
RL   Submitted (30-SEP-2010) to the EMBL/GenBank/DDBJ databases.
RL   Sequencing Lab, Shanghai Biosune Biotechnology Co. Ltd., Donglan Road No.
RL   248, 5th floor, Shanghai 201102, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .633
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus reticulata"
FT                   /mol_type="genomic RNA"
FT                   /country="Pakistan"
FT                   /collection_date="2008"
FT                   /clone="188"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .630
FT                   /codon_start=1
FT                   /product="P23"
FT                   /protein_id="ADU02571.1"
FT                   /translation="MDNTSGQTFISVNLSDESHTASTEVKTVSSEADRLEFLRKMNPFI
FT                   IDALIRKTSYQGARFRARIIGVCVDCGRKHDKGSRTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLSKRKARAFSNAEMFAIDLVMYTKERQLAVDLAAEREKTRLARKHPMRSPEETPEH
FT                   YKFGMTAKAMLPDVNVVDVGDNEDTSSEYPVSLSISGGVLREHHFI"
XX
SQ   Sequence 633 BP; 194 A; 124 C; 156 G; 159 T; 0 other;

hq329244 Length: 633  29-DEC-2010  Type: N  Check: 9858  ..

       1  atggataata ctagcggaca aactttcatt tctgtgaacc tttctgacga
      51  aagccacacg gctagtactg aagttaaaac cgtaagttct gaagcggatc
     101  gcttggaatt tttacggaaa atgaatccct ttattatcga tgctttaata
     151  cggaaaacca gttatcaggg tgctcgcttt cgcgcgagaa taataggagt
     201  atgcgtggat tgtggtagaa aacacgacaa ggggtcgagg accgaacgta
     251  agtgtaaggt caacaacaca cagtctcaga acgaggtggc gcatatgtta
     301  atgcacgatc ccgttaagta tttaagtaaa agaaaagcta gagccttttc
     351  taacgcagag atgtttgcga tcgatttggt tatgtacacc aaagaaaggc
     401  aattagcggt tgatttggcc gctgaaaggg aaaagacgag actggctcgt
     451  aaacacccaa tgcgttctcc ggaagaaact ccggaacatt ataaattcgg
     501  tatgactgct aaagcaatgt taccggacgt caacgtcgta gacgttggtg
     551  acaacgaaga tacttcgtcg gagtacccag taagtctgag tatttctggc
     601  ggagttctcc gtgaacacca cttcatctga ttg