Sequence of DPV Citrus tristeza virus

Citrus tristeza virus clone 231 P23 gene, complete cds.

ACC No: HQ329246

Dated: 2010-12-29 | Length: 633 | CRC: 605776805

                
ID   HQ329246; SV 1; linear; genomic RNA; STD; VRL; 633 BP.
XX
AC   HQ329246;
XX
DT   29-DEC-2010 (Rel. 107, Created)
DT   29-DEC-2010 (Rel. 107, Last updated, Version 1)
XX
DE   Citrus tristeza virus clone 231 P23 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-633
RA   Atta S.;
RT   "citrus tristeza virus from Pakistan";
RL   Unpublished.
XX
RN   [2]
RP   1-633
RA   Atta S.;
RT   ;
RL   Submitted (30-SEP-2010) to the EMBL/GenBank/DDBJ databases.
RL   Sequencing Lab, Shanghai Biosune Biotechnology Co. Ltd., Donglan Road No.
RL   248, 5th floor, Shanghai 201102, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .633
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus reticulata"
FT                   /mol_type="genomic RNA"
FT                   /country="Pakistan"
FT                   /collection_date="2008"
FT                   /clone="231"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .630
FT                   /codon_start=1
FT                   /product="P23"
FT                   /protein_id="ADU02573.1"
FT                   /translation="MDNTSGQTFISVNLSDESNTASTEVKTVSSEVDRLEFLRKMNPFT
FT                   IDALIRKPSYQGARFRARIIGVCVDCGRKHDKASRTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAEMFAIDLVMHTKEKQLAVDLAAEREKTRLARRHPMRSPEETPEY
FT                   YKFGMTAKAMLPDINAIDVGDNEDTSSEYPVSLSVSGGVLREHHFI"
XX
SQ   Sequence 633 BP; 192 A; 124 C; 160 G; 157 T; 0 other;

hq329246 Length: 633  29-DEC-2010  Type: N  Check: 1411  ..

       1  atggataata ctagcggaca aactttcatt tctgtgaacc tttctgacga
      51  aagcaacaca gctagcactg aagtcaaaac cgtaagttcg gaagtggatc
     101  gcttggaatt tttacggaaa atgaatccct ttactatcga cgccttgata
     151  cggaaaccca gttatcaggg tgctcgcttt cgcgcgagaa taataggagt
     201  gtgcgtggat tgtggtagaa aacacgataa ggcatcgagg actgaacgta
     251  agtgtaaggt caacaataca caatctcaga acgaggtggc gcatatgtta
     301  atgcacgatc ccgtgaaata tttaaataaa agaaaggcta gagccttttc
     351  taacgcagag atgtttgcga tcgatttggt tatgcatacc aaagaaaagc
     401  aattagcggt tgatttggcc gctgaaaggg agaagacgag attggctcgt
     451  agacacccga tgcgttctcc ggaggaaact ccggaatatt ataagttcgg
     501  tatgactgct aaggcaatgt taccggacat caacgctata gacgttggtg
     551  ataacgagga cacttcgtcg gaatacccag tgagtctgag tgtttcaggc
     601  ggagttctcc gtgaacacca cttcatctga ttg