Sequence of DPV Piscine myocarditis virus

Piscine myocarditis virus AL V-708, complete genome.

ACC No: HQ339954

Dated: 2011-05-22 | Length: 6688 | CRC: 2016111456

                
ID   HQ339954; SV 1; linear; genomic RNA; STD; VRL; 6688 BP.
XX
AC   HQ339954;
XX
DT   07-NOV-2010 (Rel. 106, Created)
DT   22-MAY-2011 (Rel. 108, Last updated, Version 2)
XX
DE   Piscine myocarditis virus AL V-708, complete genome.
XX
KW   .
XX
OS   Piscine myocarditis virus AL V-708
OC   Viruses; dsRNA viruses; Totiviridae.
XX
RN   [1]
RP   1-6688
RX   DOI; 10.1128/JVI.02154-10.
RX   PUBMED; 21411528.
RA   Haugland O., Mikalsen A.B., Nilsen P., Lindmo K., Thu B.J., Eliassen T.M.,
RA   Roos N., Rode M., Evensen O.;
RT   "Cardiomyopathy Syndrome of Atlantic Salmon (Salmo salar L.) Is Caused by a
RT   Double-Stranded RNA Virus of the Totiviridae Family";
RL   J. Virol. 85(11):5275-5286(2011).
XX
RN   [2]
RP   1-6688
RA   Haugland O., Mikalsen A.B., Nilsen P., Lindmo K., Thu B., Eliassen T.M.,
RA   Rode M., Evensen O.;
RT   ;
RL   Submitted (05-OCT-2010) to the INSDC.
RL   Department of Basic Sciences and Aquatic Medicine, Norwegian School of
RL   Veterinary Science, Ullevalsveien 72, Oslo, Norway 0454, Norway
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .6688
FT                   /organism="Piscine myocarditis virus AL V-708"
FT                   /host="Salmo salar L. (Atlantic salmon)"
FT                   /isolate="AL V-708"
FT                   /mol_type="genomic RNA"
FT                   /country="Norway"
FT                   /collection_date="2007"
FT                   /db_xref="taxon:912320"
FT   CDS             445. .3030
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /note="structural protein; ORF1"
FT                   /db_xref="GOA:E3W911"
FT                   /db_xref="UniProtKB/TrEMBL:E3W911"
FT                   /protein_id="ADP37186.1"
FT                   /translation="MEPNTSVIATEQQQAAMREVEAEAAARDEVVEKIAFAEGAMMVQT
FT                   RRLPSGKSSVGGFLGELAQNIRAMNRSLHTDTNMLTEGAMVDRARAKVHKIIREGNLDS
FT                   RVFSNTGSNTMLSLWVPAVPGPPAVPEHWDVAPSWFVCRPGKKGGIKITQSASMAALNP
FT                   LFRGADVGPIGTAVRADVNAFSMNAVLGALRAGGFNTEHSLVSFVEPLIRILLMGVQTQ
FT                   DRGTSPWDWVGGMSSRIVNPLVFTTSGNFFPGGPNLRVWGANDTVARIVNVEDYMREAA
FT                   GEGRFDAGWGPEFWGGTGDDAVAVVPIRAVEAGLGEVNAGWTLAHMEYPVKVRLLDVDD
FT                   RTIGPGGSLPLNANREYTAAGATHVPGPYARVLYVVVDQNADRCVGVRVQGQGAVIDVD
FT                   PALNYVIGGADLGMLPLIQWSVGLGAEDMAQGSIAQTQRWVRMYGNEDDWESAWHLVSS
FT                   AYTVYSPAFRRSGVAVEGGFWAQPAAGAAPFPLGGLAGWVRYDNQARAAQVALCRERAD
FT                   MAECPWGGYRERGVRPGSVANWQYVRFDPTVAVGVAAHFWSVVKVMVAPVPDRAAALAD
FT                   MAWGKGKVQAMGEDVINGQMGQPESMMRGVALNENQGLAAATVRRVVGLENESMQTTHW
FT                   STTEVAMNGYYGRAGATAHHAAFPLSEGGTMRKRIPAIEMRENGVEGDLMNDDLYSIGT
FT                   AAGYLAVEGMAGAQGGIWDVVQYQLPGPDDEARGVMNTVGAMGGWTRAVTPVDNVATMR
FT                   DNGVEGEPCGIVMSLPTSGTAVVDRLANFGLPPARAELREVPFGGYQRSVTNTNHRVKV
FT                   SVSGGRAVVQKGNKAEMNPVFVNRTPGQTTLGQPTTDTTGMTTADFLDI"
FT   CDS             3114. .5294
FT                   /codon_start=1
FT                   /product="RNA-dependent RNA polymerase"
FT                   /note="nonstructural protein; ORF2"
FT                   /db_xref="GOA:E3W912"
FT                   /db_xref="InterPro:IPR001795"
FT                   /db_xref="UniProtKB/TrEMBL:E3W912"
FT                   /protein_id="ADP37187.1"
FT                   /translation="MITKALAQGREEDWIKITTNTTKIKLKSLRPLDGWEHSGWGLGLR
FT                   LALELVSEPTRETMSGVIRQIRIGKLDPTKVFKSISNQAKVSGCGLCREWKEYVNWELL
FT                   GGYQMITAQQMGEEVAHQVTEKAKSEEAGSDRINRALESILGPLRGTCTVPCSQREFLL
FT                   CRDKWAKNTSGYIGLGQNLGRQKIDVALNSDIKALERMMEGEFENRPFIKSEPGKSRPV
FT                   VNSNISCYLNLEYGWVTIKKTLKKYLGKRTTIFDDASQKVLLWQEMIIGADNHREIKVP
FT                   LDYSRFDSTIGKTQIMKCVRLLLDMVRGNDNWKRSVTERFERQTVYIDGYGKLRWENSV
FT                   LSGWRWTSIITSVINLAILKATGADASGVGIKVQGDDVKISFQTIREAERCVEEINALG
FT                   YEINPGKVFASRKRDEYLRMVAEEGKMAGYVIRCLPKIVFTSPTEEVTTWEERIRGTVS
FT                   KWMRVLSRGGDREVAKYWMKRDLCGLSGENSELIDSWLRTPASVGGGGCAWLLGEGNLW
FT                   TGLVLREQEEAEVVERSNHKMMSDYGGSVPARRWIKSVTKGAKPAFGFKRIERVKPLGN
FT                   WLKDLRPVAESIKSISDLVETSQVPKFRFKEIYDWTPFMVHKRNALIEEKNWDKLCSLY
FT                   HNEGEVRLYKRILPRWMWLSMIKNELTWVSMPPNIANSEVASLAKERVEYKVLSKVLRY
FT                   HRTVSRETLTRFSIGGEYVLSAKLNDRQRILQ"
FT   CDS             5542. .6450
FT                   /codon_start=1
FT                   /product="structural protein"
FT                   /note="ORF3"
FT                   /db_xref="GOA:E3W913"
FT                   /db_xref="InterPro:IPR001811"
FT                   /db_xref="UniProtKB/TrEMBL:E3W913"
FT                   /protein_id="ADP37188.1"
FT                   /translation="MSNKMKSFLLVLLCLCVGEGIVPMFRREWCLCTAGNARVPLVGEG
FT                   RAEKIELFNQSATCGKKELIITWKGKRWCYDIESKRGKILVKTLSGGGHLEREGKGYKL
FT                   VRNGFHLASFGGKKEEIQDSSHIEKVNGKDAIVKKGQHVEHLPGGNDLIVTEGGNLCGN
FT                   VGFFDNTQCTYNSVINIGGGSVDNSQEAKNDKSNTIDNLIDMLPLVVGIAGGCLIVIVV
FT                   LYLTIKYCKCKKKRTNPEPAEPEEHEMRDLRRRLEPRPPYQRQMGVEFEINEALEFMGV
FT                   EGSESPDSGCQSDEEGFRVGV"
XX
SQ   Sequence 6688 BP; 2022 A; 1197 C; 2130 G; 1339 T; 0 other;

hq339954 Length: 6688  22-MAY-2011  Type: N  Check: 6693  ..

       1  aaaaagacaa cagaaaaacc gagaaaatct ctctttttcc tgaactaaac
      51  tggtgcatag ttcagtaaca aaccatccgc tttgcaacag ggaagcgggc
     101  cgtaactcca gtggtgacat ggggaacgga cattagctta ctccgctaag
     151  ggagtgagga gacctgactg aggaagtagg atgcacctca ggacttagaa
     201  ttcggtttag tcatctatgg tagtgacccc aaaacgacta gttcgggaac
     251  gggggacccc actgccgcag gggtatcgac gggctactac acccacttca
     301  gccttccctc cggggggggt agaaaggtgg gtcgagcggt gaggagaagg
     351  gttgtcaaat taaaacaact ctccgactgc gatcttattt cggtagtccc
     401  gggccggcgt tgatactcag gtaaggtccg gatgtcaacc aactatggaa
     451  ccaaacacat ctgtcattgc aacggagcag cagcaggctg ccatgagaga
     501  ggtggaggcc gaggcggcgg ccagagacga agtggtggag aagatcgcat
     551  tcgctgaagg agcgatgatg gtacagacga ggaggttacc atcaggaaag
     601  tcgtcggtag gaggttttct cggcgaactg gcacagaaca tacgtgccat
     651  gaatcggtca ttgcacacag ataccaacat gctgaccgaa ggggcgatgg
     701  tggacagagc gagggcaaaa gtacacaaaa tcattaggga agggaatttg
     751  gactctaggg tattttcaaa cacggggagc aacactatgt tgtcactgtg
     801  ggtaccagca gtaccgggac caccggcagt accggagcat tgggacgttg
     851  cgccgtcctg gttcgtatgc agaccgggga aaaagggggg gataaagatc
     901  acacaaagcg catcaatggc agcattaaac ccactattta gaggcgcaga
     951  cgtggggcca atcgggacag cagtcagggc ggatgtaaac gcattttcaa
    1001  tgaatgcagt tctgggagca ctaagagccg ggggatttaa caccgaacat
    1051  tccctggtgt cattcgttga accactaatt cggatcttgc taatgggggt
    1101  acaaacacaa gacaggggga ccagcccatg ggattgggtt ggagggatga
    1151  gttcgcgaat agtcaatccc ctagtattca caacaagcgg gaacttcttc
    1201  ccagggggac caaatttgag ggtgtgggga gccaacgata cagtggccag
    1251  gatagtaaac gttgaggact acatgcgcga ggcggccggg gaggggaggt
    1301  tcgacgctgg atggggaccg gaattctggg gtgggacagg ggacgacgca
    1351  gtggcggtgg taccgataag ggcagtagaa gcagggctag gagaagtaaa
    1401  cgcagggtgg acattggcac acatggaata cccagtcaag gttagactac
    1451  ttgacgtcga cgaccgaaca attggaccag gggggagcct gcccctaaac
    1501  gcaaacagag aatacacggc ggcaggagct acgcatgtac ccgggcccta
    1551  tgccagggta ctgtacgtcg tcgtggacca aaacgcagac aggtgtgtgg
    1601  gggtgagagt gcagggacag ggtgctgtaa ttgacgtgga tccggcgttg
    1651  aattacgtga tagggggagc ggatttgggg atgttgccgt tgatacagtg
    1701  gagtgtaggg ctgggggccg aggacatggc gcagggatcg attgcacaga
    1751  cgcagcgatg ggtgaggatg tatggaaacg aggacgattg ggaatcagcg
    1801  tggcatctag tgtctagcgc gtacacagtg tacagcccgg cattcaggag
    1851  atcgggtgtc gcagtggagg gaggattctg ggcgcaacca gctgcagggg
    1901  cagcaccgtt tccactagga ggattggcag ggtgggtgag gtacgacaat
    1951  caggcacggg cggcgcaggt tgcactttgc agagagaggg cggatatggc
    2001  ggagtgtcct tggggggggt acagggagag aggggtgaga ccggggagtg
    2051  tggcaaactg gcagtacgta aggttcgatc ccacagtggc tgtaggagta
    2101  gctgctcact tctggtcggt agtgaaggtg atggtggctc ccgtcccaga
    2151  cagagcggct gctctggcgg acatggcgtg ggggaagggg aaggtgcaag
    2201  ccatgggtga ggatgtgatc aacgggcaga tgggacaacc tgagtccatg
    2251  atgagagggg tggcgctgaa cgagaaccag ggactagcgg cggctacagt
    2301  caggagggtg gttgggctgg agaacgagtc gatgcaaaca acgcactgga
    2351  gtacaacgga ggtagcaatg aacgggtact acgggagagc aggagcaaca
    2401  gcacaccacg ctgcatttcc gttgtccgag ggggggacaa tgcgaaaacg
    2451  aataccagct atagagatga gggagaacgg ggtggagggg gacctgatga
    2501  acgatgatct ctattcaatt ggaacggcag cggggtacct ggcggtagag
    2551  gggatggcag gtgcgcaggg gggtatctgg gacgtggtcc agtaccagct
    2601  gcctgggcct gacgatgagg cgaggggggt gatgaacacg gtgggggcga
    2651  tggggggatg gacgagggcg gtgacaccag tagacaatgt ggccaccatg
    2701  agggacaacg gggttgaggg ggaaccttgt ggaatagtga tgtctctacc
    2751  aacaagtggg accgctgtgg tggataggtt agctaatttc ggattaccac
    2801  cagcgagggc ggaattaaga gaagtaccat ttggcgggta ccaaagatca
    2851  gtcacaaaca ccaaccacag agtcaaggtg agtgtgagtg gggggcgagc
    2901  agttgttcaa aaagggaaca aagccgagat gaatccagtc tttgtcaata
    2951  ggacaccagg acaaacgacc ctaggccaac caacaacaga cactacaggg
    3001  atgacaactg cagatttttt agatatatag acccctgggc accaaaaaga
    3051  agtagaaaga ggaatgcagt tggagcacta ctacaattag acccaaattt
    3101  aggacttaag agaatgataa ccaaagcatt ggcccaggga cgagaagaag
    3151  attggattaa gataaccacc aatactacaa agatcaaatt gaaatcacta
    3201  aggccactgg atggatggga gcattcagga tggggactgg gactgaggtt
    3251  agccttagaa ctagtttctg agccaacgag agagacaatg tcaggggtaa
    3301  ttagacaaat taggataggg aagctagatc caaccaaggt atttaaatca
    3351  attagtaacc aggcgaaagt tagcgggtgc gggctatgta gggagtggaa
    3401  ggagtacgta aattgggaat tactaggggg gtaccagatg ataacagccc
    3451  aacagatggg tgaagaggta gcacaccagg tgaccgaaaa ggctaaaagc
    3501  gaggaagcgg gaagcgatag gataaatagg gcattagaat caattttagg
    3551  gccactaagg ggtacatgca cggtaccgtg ctcacaaagg gaatttttat
    3601  tatgtaggga taaatgggcc aaaaacacgt ccgggtacat agggttaggg
    3651  caaaatttag ggcgacagaa gatagacgta gcacttaatt cagacatcaa
    3701  ggcactggaa aggatgatgg agggagaatt cgagaacaga ccatttatta
    3751  aaagtgaacc agggaaaagc aggccggtag ttaatagtaa tatatcgtgt
    3801  tacctaaatt tagagtatgg gtgggtaacc attaaaaaga cactgaaaaa
    3851  atacttaggc aagaggacaa caattttcga cgacgcaagc caaaaggtac
    3901  tgttatggca agaaatgata attggagcag ataaccatag ggagattaaa
    3951  gtgccactag actactcgcg gttcgattca acaattggga aaacgcaaat
    4001  catgaagtgt gttagactgc tattagacat ggtgcgaggt aacgacaatt
    4051  ggaaaaggtc agttactgaa agattcgaga gacaaacggt gtacattgac
    4101  ggttacggaa aactcaggtg ggaaaacagc gtacttagcg gatggagatg
    4151  gacaagtata atcacatctg taataaattt ggccattctt aaggcgaccg
    4201  gagccgatgc gagcggagta gggattaaag tccagggaga tgatgttaaa
    4251  atcagcttcc aaacaattcg agaagcggaa aggtgtgtcg aagaaattaa
    4301  cgctttaggg tatgaaatta acccgggtaa agtatttgcg tcaaggaaaa
    4351  gggacgagta tctcaggatg gtagcggaag aggggaaaat ggcaggttat
    4401  gtaattaggt gtctaccgaa aattgtattt acatcaccaa cagaagaggt
    4451  taccacatgg gaagaacgaa ttaggggaac agtgtcaaaa tggatgaggg
    4501  tgttatcacg ggggggggat agggaagtag ctaaatattg gatgaaacgc
    4551  gatttgtgtg gattgagtgg agagaattcg gaattaatag atagctggtt
    4601  acgtactcca gcatccgtgg gggggggtgg ttgtgcatgg ttacttgggg
    4651  agggaaattt gtggacggga ttagtactta gggaacagga ggaagcagaa
    4701  gtggtggagc gttcaaatca caaaatgatg tcggattacg gggggtcagt
    4751  tcctgcccgt agatggatca agagtgtgac gaagggcgca aaaccggctt
    4801  ttgggttcaa gaggatagag agggtaaagc cactagggaa ctggttaaaa
    4851  gatctaaggc cagtggcgga atcaattaaa tcaattagtg acttagtcga
    4901  aacatcacag gtaccaaaat tcagatttaa ggaaatttat gattggacac
    4951  cattcatggt acacaagagg aacgcgctca tagaagaaaa gaactgggac
    5001  aaattgtgct cgctttatca taatgaaggg gaagtgagac tatataaaag
    5051  gatattaccc aggtggatgt ggctgagtat gataaaaaat gagttaacat
    5101  gggtaagtat gccaccaaac attgctaatt cggaagttgc ttcacttgca
    5151  aaagaaagag tggagtacaa agtgttgagt aaagtattga ggtatcaccg
    5201  aaccgtctca agagaaacgc tcactcgttt ttctattggt ggggagtatg
    5251  tactgagtgc taaactcaac gacaggcaaa ggatattaca gtaggacggt
    5301  ggtagctgaa acaggggcta ctagcacaaa gaagctatct ggaatagggg
    5351  atagtgtaac ctgatcacgg aactaatacg caccgtgtac ctattagtaa
    5401  ggcgtatatg gtaggtgccg gaggaggcga cgatcccggg acttcactta
    5451  ccgcagaggc agctatagta ggttaggcgt ggaattccgg ccattttaga
    5501  ggacctattc ggaccggcgt ggttgtcgaa gtaagacccg gatgtcaaac
    5551  aagatgaaga gttttttact ggtgctttta tgtttgtgtg taggggaagg
    5601  gattgttcca atgttcaggc gagaatggtg tttgtgcact gcagggaatg
    5651  cgagagtacc cttggtggga gagggaaggg ctgagaagat cgagctattc
    5701  aatcagagcg ccacatgtgg gaagaaagag ctaataataa cgtggaaggg
    5751  aaagaggtgg tgctacgata ttgagagcaa gcgagggaaa atactagtaa
    5801  agacactgag cggaggggga catctggaac gagagggaaa ggggtacaag
    5851  ttagttagga acgggttcca tcttgcttca ttcgggggta aaaaagagga
    5901  aatacaggat tcaagtcaca tagagaaagt aaacgggaaa gacgcgatag
    5951  ttaagaaagg gcaacacgta gaacatcttc caggggggaa cgatttaatt
    6001  gttacagagg gcgggaacct gtgtgggaac gtggggttct tcgataatac
    6051  gcagtgtaca tacaacagtg ttataaatat aggaggggga agtgttgaca
    6101  attcacaaga agccaagaac gataaatcaa acacaattga caatttaatt
    6151  gatatgttac ctttagttgt aggaatagcc gggggctgtc tcatagtgat
    6201  agtagtctta tacttaacaa ttaaatactg taaatgcaag aagaagagga
    6251  ccaacccaga accagcggaa ccggaggaac acgagatgag ggatctcagg
    6301  agaaggttag agccacgccc tccataccaa agacagatgg gtgttgagtt
    6351  tgaaataaat gaagctctcg aattcatggg cgtcgaaggg agtgaaagcc
    6401  cagactcagg atgtcagtca gatgaagagg gattcagagt aggagtctag
    6451  atggaacgaa gagataggtc accactatcg tccgcatata attttacaca
    6501  attggactag tactattgta caggggtacc atttaccctg ccagaccgac
    6551  aaataggtcg ggtgtttagt gagaaagtcg ctagcacctg ggcgaaagat
    6601  ggggcaacat actgactctt gggagtgaga ccagggggaa gtatgtaagg
    6651  catggttagg cttgaccccg tgggtcaagg ccgtgctg