Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate CS-7 major coat protein (CP) gene, complete cds.

ACC No: HQ634290

Dated: 2011-02-06 | Length: 672 | CRC: 348582249

                
ID   HQ634290; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   HQ634290;
XX
DT   06-FEB-2011 (Rel. 107, Created)
DT   06-FEB-2011 (Rel. 107, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate CS-7 major coat protein (CP) gene, complete
DE   cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Cheng X., Wu J., Ma X., Wu X.;
RT   "First report of Citrus tristeza virus infecting Huyou (Citrus
RT   changshanensis)";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Cheng X., Wu J., Ma X., Wu X.;
RT   ;
RL   Submitted (18-NOV-2010) to the EMBL/GenBank/DDBJ databases.
RL   College of Agricultural and Food Science, Zhejiang Agricultural and
RL   Forestry University, 88# North Huangcheng Rd., Linan, Zhejiang 311300,
RL   China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus aurantium"
FT                   /isolate="CS-7"
FT                   /mol_type="genomic RNA"
FT                   /country="China:Zhejiang"
FT                   /collection_date="01-Aug-2010"
FT                   /note="Agdia CTV ELISA reagent set test positive"
FT                   /db_xref="taxon:12162"
FT   gene            1. .672
FT                   /gene="CP"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="major coat protein"
FT                   /note="p25"
FT                   /protein_id="ADW54436.1"
FT                   /translation="MDDETKKLKNKDKETKEGDNVVAAESSFGSINLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDNTGII
FT                   YTREGVEVDLPDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFSRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 203 A; 124 C; 163 G; 182 T; 0 other;

hq634290 Length: 672  06-FEB-2011  Type: N  Check: 479  ..

       1  atggacgacg aaacaaagaa attgaagaac aaagacaagg aaacgaaaga
      51  aggcgacaat gttgttgctg ctgagtcttc tttcggttcc ataaacttac
     101  atatcgatcc aactctgata gcgatgaatg acgtgcgtca gttgggtacc
     151  caacagaacg ctgctttaaa cagagactta tttcttactt tgaaaggtaa
     201  gtatcctaac ttacctgaca aagataagga ttttcacata gctatgatgt
     251  tgtatcgttt agcagttaag agttcatcat tacaaagcga tgacgacaat
     301  acgggtataa tatacactcg ggagggtgtt gaagtggatt tacctgacaa
     351  actttggact gacgtcgtgt ttaactccaa gggtattggt aaccgtacta
     401  acgcccttcg agtttggggt agaactaacg atgcccttta cttagctttt
     451  agtagacaga atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcttg accggagccg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaaaaagc gaggggctga tgaagtcgta gttaccaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga