Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate CS-7 minor coat protein (CPm) gene, complete cds.

ACC No: HQ634291

Dated: 2011-02-06 | Length: 723 | CRC: 401530031

                
ID   HQ634291; SV 1; linear; genomic RNA; STD; VRL; 723 BP.
XX
AC   HQ634291;
XX
DT   06-FEB-2011 (Rel. 107, Created)
DT   06-FEB-2011 (Rel. 107, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate CS-7 minor coat protein (CPm) gene, complete
DE   cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-723
RA   Cheng X., Wu J., Ma X., Wu X.;
RT   "First report of Citrus tristeza virus infecting Huyou (Citrus
RT   changshanensis)";
RL   Unpublished.
XX
RN   [2]
RP   1-723
RA   Cheng X., Wu J., Ma X., Wu X.;
RT   ;
RL   Submitted (18-NOV-2010) to the EMBL/GenBank/DDBJ databases.
RL   College of Agricultural and Food Science, Zhejiang Agricultural and
RL   Forestry University, 88# North Huangcheng Rd., Linan, Zhejiang 311300,
RL   China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .723
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus aurantium"
FT                   /isolate="CS-7"
FT                   /mol_type="genomic RNA"
FT                   /country="China:Zhejiang"
FT                   /collection_date="01-Aug-2010"
FT                   /note="Agdia CTV ELISA reagent set test positive"
FT                   /db_xref="taxon:12162"
FT   gene            1. .723
FT                   /gene="CPm"
FT   CDS             1. .723
FT                   /codon_start=1
FT                   /gene="CPm"
FT                   /product="minor coat protein"
FT                   /protein_id="ADW54437.1"
FT                   /translation="MAGYTVLPNTDDKEMDPVSAAVPGKYPDVIEKYVANRSVDALIEG
FT                   VISKLDTNSIYEDSTEKFTGEHLKYVMVTMDTFLLENYKTKTEDLLVHLAMIQKRLCTI
FT                   STSTKTKFRDKGCISYVQGGLRYKLMDKVVFPFIISKFTDRETPNALRKYACTFEELHL
FT                   CMAKLRPDLYENKRTTKAGTPHLKGYLSADFLSGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATELLNLRDLGKYL"
XX
SQ   Sequence 723 BP; 221 A; 140 C; 164 G; 198 T; 0 other;

hq634291 Length: 723  06-FEB-2011  Type: N  Check: 7027  ..

       1  atggcaggtt atacagtact tcctaatacc gatgacaaag aaatggatcc
      51  ggtgagtgcc gccgtgcccg gtaagtatcc ggatgttatt gaaaaatatg
     101  tggccaatag gtccgtagac gcgttaatag aaggcgttat aagtaagttg
     151  gataccaatt caatatacga agattccact gaaaaattta ctggtgaaca
     201  cttgaaatac gttatggtta ctatggatac tttcttatta gaaaactaca
     251  agacgaaaac ggaagatctg ttggttcact tagctatgat ccaaaagagg
     301  ttgtgcacta tatccacgag cactaaaacc aagttccgcg ataaaggttg
     351  cattagttac gtgcaaggag gtttgcgata taagttaatg gataaagtag
     401  tttttccttt cattatatcg aaattcaccg atagggagac tccgaacgct
     451  ctacgtaagt atgcttgcac tttcgaggag ttacacttgt gtatggctaa
     501  gttgagaccc gacttatacg aaaataaaag gacgaccaaa gccgggactc
     551  cacacttaaa gggctactta tcagccgact ttctttcagg ttctctccca
     601  gggtactccg aacatgaacg aggcatcatt cttcgagcgt ctgagtctat
     651  gttagctaga cgtcaaggtt acgaagaggc aaccgagctt cttaacctac
     701  gtgatttggg taagtacttg tag