Sequence of DPV Moroccan pepper virus

Moroccan pepper virus coat protein (cp) gene, complete cds.

ACC No: HQ663881

Dated: 2011-03-16 | Length: 1176 | CRC: 419686426

                
ID   HQ663881; SV 1; linear; genomic RNA; STD; VRL; 1176 BP.
XX
AC   HQ663881;
XX
DT   16-MAR-2011 (Rel. 108, Created)
DT   16-MAR-2011 (Rel. 108, Last updated, Version 1)
XX
DE   Moroccan pepper virus coat protein (cp) gene, complete cds.
XX
KW   .
XX
OS   Moroccan pepper virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-1176
RA   Beikzadeh N., Peters D., Hassani-Mehraban A.;
RT   "First report of Moroccan pepper virus (MPV) infecting Lisianthus in Iran";
RL   Unpublished.
XX
RN   [2]
RP   1-1176
RA   Beikzadeh N., Peters D., Hassani-Mehraban A.;
RT   ;
RL   Submitted (01-DEC-2010) to the EMBL/GenBank/DDBJ databases.
RL   Laboratory of Virology, Wageningen University, Dept. of Plant Sciences,
RL   Droevendaalsesteeg 1, Wageningen 6708 PB, The Netherlands
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1176
FT                   /organism="Moroccan pepper virus"
FT                   /host="Eustoma russellianum"
FT                   /mol_type="genomic RNA"
FT                   /country="Iran"
FT                   /isolation_source="leaf"
FT                   /collection_date="10-Jun-2010"
FT                   /db_xref="taxon:208086"
FT   gene            1. .1176
FT                   /gene="cp"
FT   CDS             1. .1176
FT                   /codon_start=1
FT                   /gene="cp"
FT                   /product="coat protein"
FT                   /protein_id="ADZ45531.1"
FT                   /translation="MAMVVRNNNTALVPYSGGKRGLQKAFGFGATIVGQKIYDNRGKIV
FT                   GFMVEQGKKGLSKMANALGYGNGQKAQNLVGGMGGAIMAPVAVSRQLRGSKPRFTGRTA
FT                   GSVTVTHREYVRQVNNTSAFTVNGGIVGNLYQLNPLNGTLFTWLPSIASNFDQYTFNNI
FT                   TLHYVPLCSTTEVGRVGLYHDKDSQDPEPTDRQELANFSTLKETPPWGEVMLRIPTDRI
FT                   KRYCDDSNAVDHKLIDLGQVGIATYGGAGANAVGDVFISYSITLFSPQPTSSLLSTRQQ
FT                   SLLGATGLTTGPSYLTVSSTATVLTLTFRATGTFMVSGHFRDTGAAVLGLAGNINVNSL
FT                   TVLDTVGLATSFSINCSVSALPSTITFTSTAITSSTVHCVRAVRANDATLL"
XX
SQ   Sequence 1176 BP; 296 A; 273 C; 293 G; 314 T; 0 other;

hq663881 Length: 1176  16-MAR-2011  Type: N  Check: 3906  ..

       1  atggcaatgg tagtaagaaa caacaacaca gcactagtac cgtatagtgg
      51  aggcaagcgt ggcctccaga aagcatttgg atttggagct acaatcgtcg
     101  ggcaaaagat ttatgataat cgcggtaaga ttgtagggtt catggtagaa
     151  caaggaaaga aaggtttaag taagatggct aacgctctcg gttatggcaa
     201  tggtcagaaa gctcagaatc tggttggtgg gatgggtggg gccattatgg
     251  ctcctgttgc ggtttcgagg cagcttcgtg ggagtaaacc ccggtttact
     301  ggacgtacag ctggttctgt tactgtcacc caccgcgagt atgtacgaca
     351  ggtaaacaac acgtctgcct tcacagtcaa tgggggtatt gtcgggaatt
     401  tgtatcaact gaaccctttg aacggtaccc tgttcacttg gttgccctcc
     451  atagcatcca attttgatca atacacgttc aataacatca cgttgcacta
     501  tgtccccctc tgtagcacta ctgaggtagg tcgtgttgga ttatatcatg
     551  acaaagactc acaggatcct gagcctactg ataggcagga gttggcgaac
     601  tttagtaccc ttaaagagac acccccctgg ggtgaagtaa tgttgcgaat
     651  acccactgat aggatcaaga ggtactgcga tgacagtaac gcagtcgatc
     701  ataagctaat tgatttgggt caagtaggca ttgctacata tgggggtgct
     751  ggcgctaacg ctgtaggtga tgtgtttata tcgtatagca ttactttatt
     801  ctcacctcag cccactagct cattgcttag cacaagacaa cagagccttc
     851  tcggtgccac tggtctcacg accggcccga gttacttgac ggtgtccagt
     901  acggcgaccg ttctcacctt gacatttaga gctactggca cctttatggt
     951  ttccggtcac ttccgtgaca ctggagcagc cgtattaggt ctcgccggta
    1001  atatcaatgt aaattcactg acagtcttgg atacggttgg cctggccacc
    1051  tcgttttcca ttaactgctc agtgtctgct ttaccgtcta ccattacctt
    1101  tacctccaca gcaataacat cgtccacggt acactgtgta cgggccgtaa
    1151  gggccaatga tgccacattg ttgtaa