Sequence of DPV Carnation mottle virus

Carnation mottle virus isolate LGR movement protein (P7), movement protein (P9), and coat protein (CP) genes, complete cds.

ACC No: HQ704794

Dated: 2011-07-27 | Length: 1790 | CRC: 1585612618

                
ID   HQ704794; SV 1; linear; genomic RNA; STD; VRL; 1790 BP.
XX
AC   HQ704794;
XX
DT   27-JUL-2011 (Rel. 109, Created)
DT   27-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Carnation mottle virus isolate LGR movement protein (P7), movement protein
DE   (P9), and coat protein (CP) genes, complete cds.
XX
KW   .
XX
OS   Carnation mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1790
RA   Tong A.Z., Wang L.C., Li X.P., Kong B.H., Chen H.R., Cai H.;
RT   "Carnation mottle virus p7 gene, p9 gene and cp gene, genomic RNA, isolate
RT   Yunnan, China";
RL   Unpublished.
XX
RN   [2]
RP   1-1790
RA   Tong A.Z., Wang L.C., Li X.P., Kong B.H., Chen H.R., Cai H.;
RT   ;
RL   Submitted (15-DEC-2010) to the INSDC.
RL   College of plant protection, Yunnan Agriculture University, Kunming, Yunnan
RL   650201, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1790
FT                   /organism="Carnation mottle virus"
FT                   /host="carnation"
FT                   /isolate="LGR"
FT                   /mol_type="genomic RNA"
FT                   /country="China"
FT                   /collection_date="Sep-2010"
FT                   /db_xref="taxon:11986"
FT   gene            349. .534
FT                   /gene="P7"
FT   CDS             349. .534
FT                   /codon_start=1
FT                   /gene="P7"
FT                   /product="movement protein"
FT                   /protein_id="AEK77597.1"
FT                   /translation="MDIEPEVPVVGKQMLAGNRGKQKTRRSVAKDAIRKPASDSTNGGN
FT                   WVNVADKIEVHIHFNF"
FT   gene            440. .694
FT                   /gene="P9"
FT   CDS             440. .694
FT                   /codon_start=1
FT                   /gene="P9"
FT                   /product="movement protein"
FT                   /protein_id="AEK77598.1"
FT                   /translation="MPSANLHLIVLTGVIGLMLLIRLRCTFTSTFSLPPLVTLNQIIAL
FT                   SFCGLLLNSISRAERACYYNYSVDSSKQQHISISTPNGK"
FT   gene            684. .1730
FT                   /gene="CP"
FT   CDS             684. .1730
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="AEK77599.1"
FT                   /translation="MENKGEKIAMNPTVQTLAQKGDKLAVKLVTRGWASLSTNQKRRAE
FT                   MLAGYTPAILAFTPRRPRMTNPPPRTSRNSPGQAGKSMTMSKTELLSTVKGTTGVIPSF
FT                   EDWVVSPRNVAVFPQLSLLATNFNKYRITALTVKYSPACSFETNGRVALGFNDDASDTP
FT                   PTTKVGFYDLGKHVETAAQTAKDLVIPVDGKTRFIRDSASDDAKLVDFGRIILSTYGFD
FT                   KADTVVGELFIQYTIVLSDPTKTAKISQASNDKVSDGPTYVVPSVNGNELQLRVVAAGK
FT                   WCIIVRGTVEGGFTKPTLIGPGISGNVDYESARPIAICELVTQMEGQILNITKTSAEQP
FT                   LQWVVYRM"
XX
SQ   Sequence 1790 BP; 529 A; 410 C; 465 G; 386 T; 0 other;

hq704794 Length: 1790  27-JUL-2011  Type: N  Check: 7701  ..

       1  acactggaac aacgaaacaa acgcaaaaca atggctgaag tcagtaggaa
      51  tgtgcggtct gcggattgcc gggggggttc cgattgtgca agagttctac
     101  caaaaatacg ttgaaacagc cggaaatgtg aaagagaaca aaaatatcac
     151  agagaagagc agttctgggt tctttatgat ggcggatcgc gctaagcggg
     201  gctattctgc tgtgtctgaa gtgtgtcgat ttagcttcta ccaagcattc
     251  ggcatcacgc cagaccagca gatcgcgctg gaaggggaga tcaggtctct
     301  cactatcaac accaacgtgg ggccccagtg tgaagcggca gattcactat
     351  ggatattgaa ccggaagtac cagtagttgg aaagcaaatg ctcgctggaa
     401  atagaggaaa acaaaagaca cgtagatcgg tggccaagga tgccatccgc
     451  aaacctgcat ctgatagtac taacgggggt aattgggtta atgttgctga
     501  taagattgag gtgcacattc acttcaactt ttagtttgcc cccactggta
     551  actttaaatc agataatagc gttgtcattt tgtggtcttc tattaaacag
     601  catctctcgg gcagaaagag cttgctatta caactactct gttgatagtt
     651  ctaaacaaca acacatttca ataagtacac caaatggaaa ataaaggaga
     701  aaagatcgcg atgaatccca ctgtgcaaac attggcgcag aagggggaca
     751  agttagccgt aaagttggtg acaagagggt gggcctctct gagtacgaac
     801  cagaagagga gagctgaaat gcttgctgga tacacaccag cgatcctagc
     851  cttcacaccc cgacgaccac ggatgacaaa ccctcctcca agaaccagta
     901  ggaattcacc aggacaagct ggaaagtcca tgacgatgag taagaccgaa
     951  ctgctaagca ccgtcaaagg taccacgggt gttatcccaa gctttgaaga
    1001  ctgggtcgtt tccccccgaa acgtagccgt cttccctcaa ctctcgctgc
    1051  tggcgacgaa cttcaacaag taccgcatta ctgcgctcac tgtgaagtac
    1101  tcacccgcgt gcagcttcga gaccaatggg agggtggctc tgggattcaa
    1151  cgatgacgct tcggacacac caccaaccac caaggttggg ttttacgatc
    1201  tgggcaaaca tgtggaaact gctgcacaga cagctaagga tctagtgata
    1251  ccagtagacg gcaaaacccg gttcatcagg gactcggcta gtgatgatgc
    1301  caaactagtc gattttggac gaataatctt gtcaacatac gggtttgaca
    1351  aggctgacac tgtggtgggc gaattgttca tacagtacac aattgtactg
    1401  agtgacccaa ccaagacggc caaaatttca caggcaagca acgataaggt
    1451  gtcggacgga ccaacgtatg tggtcccttc ggttaatggc aacgagctgc
    1501  aactcagagt ggtagccgct gggaaatggt gcatcatagt gcggggcacg
    1551  gttgaaggag gcttcaccaa acccacactt attgggccag gaatcagcgg
    1601  taatgtagac tatgaaagtg ccagacctat cgccatttgt gagttggtga
    1651  cacaaatgga gggccagata ttgaacatca ccaagacctc agcagaacaa
    1701  ccactccaat gggttgttta taggatgtga acgcgataga aaagtttgtt
    1751  agacacgcac ggcgggacgt gttgctagag ctgccactct