Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate W093-3 coat protein gene, complete cds.

ACC No: JF310693

Dated: 2011-08-25 | Length: 672 | CRC: -554748427

                
ID   JF310693; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   JF310693;
XX
DT   25-AUG-2011 (Rel. 109, Created)
DT   25-AUG-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate W093-3 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Al-Sadi A.M., Al-Hilali S.A., Al-Yahyai R.A., Al-Said F.A., Deadman M.L.,
RA   Nolasco G.;
RT   "Molecular characterization and potential sources of Citrus Tristeza Virus
RT   (CTV) in Oman";
RL   Plant Pathol. 0:0-0(2011).
XX
RN   [2]
RP   1-672
RA   Al-Sadi A.M., Al-Hilali S.A.;
RT   ;
RL   Submitted (09-FEB-2011) to the INSDC.
RL   Department of Crop Sciences, College of Agricultural and Marine Sciences,
RL   Sultan Qaboos University, PO Box 34, Al Khoud, Mct 123, Oman
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus aurantifolia (lime)"
FT                   /isolate="W093-3"
FT                   /mol_type="genomic RNA"
FT                   /country="Oman:Madha"
FT                   /collection_date="2009"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="AEM92175.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSMNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHLAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGIEVELPDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 192 A; 125 C; 176 G; 179 T; 0 other;

jf310693 Length: 672  25-AUG-2011  Type: N  Check: 1883  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg agacgaaaga
      51  aggcgacgat gttgttgcag cagagtcttc tttcggttcc atgaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggaacc
     151  caacagaacg ccgctttgaa cagagatttg tttcttactc tgaaagggaa
     201  gtatcctaac ttgcctgaca aggataagga cttccactta gctatgatgt
     251  tatatcgttt agcggttaag agttcatcgt tgcaaagtga tgacgacacc
     301  acgggcataa catatactcg ggagggtatt gaagtggagt tgcctgacaa
     351  gctttggact gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  atgcccttcg agtctggggt aggactaacg atgcccttta tttagctttc
     451  tgtagacaga atcgcaattt gagttatggt ggacgtccgc tagatgcagg
     501  gattccggct ggatatcatt acctatgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa ggaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga