Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate W140-1 coat protein gene, complete cds.

ACC No: JF310695

Dated: 2011-08-25 | Length: 672 | CRC: 821120030

                
ID   JF310695; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   JF310695;
XX
DT   25-AUG-2011 (Rel. 109, Created)
DT   25-AUG-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate W140-1 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Al-Sadi A.M., Al-Hilali S.A., Al-Yahyai R.A., Al-Said F.A., Deadman M.L.,
RA   Nolasco G.;
RT   "Molecular characterization and potential sources of Citrus Tristeza Virus
RT   (CTV) in Oman";
RL   Plant Pathol. 0:0-0(2011).
XX
RN   [2]
RP   1-672
RA   Al-Sadi A.M., Al-Hilali S.A.;
RT   ;
RL   Submitted (09-FEB-2011) to the INSDC.
RL   Department of Crop Sciences, College of Agricultural and Marine Sciences,
RL   Sultan Qaboos University, PO Box 34, Al Khoud, Mct 123, Oman
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus aurantifolia (lime)"
FT                   /isolate="W140-1"
FT                   /mol_type="genomic RNA"
FT                   /country="Oman:Suwaiq"
FT                   /collection_date="2010"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="AEM92177.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSLNLHIDPTMIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTRDGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVAVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 198 A; 121 C; 169 G; 184 T; 0 other;

jf310695 Length: 672  25-AUG-2011  Type: N  Check: 7328  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaagga
      51  aggcgacgat gttgttgcgg ccgagtcttc tttcggttcg ttaaatttac
     101  acatcgatcc gactatgata gcgatgaacg atgtacgtca gttgggtacc
     151  caacagaatg ctgctttgaa cagagatttg tttcttacct tgaaagggaa
     201  atatcctaac ttacctgata aagataaaga ctttcacata gctatgatgt
     251  tatatcgttt agcggttaag agttcatcat tacaaagcga cgacgacact
     301  acgggtataa cgtacactcg ggatggtgtt gaggtggatt tgtctgacaa
     351  actttggact gacgtcgtgt ttaattctaa gggtattggt aaccgtacta
     401  acgcccttcg agtctggggt agaactaatg atgcccttta tttagctttt
     451  tgtagacaga accgcaactt gagttatggt ggacgtccgt tagatgcggg
     501  aattccagcc gggtatcact acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagagtgt gcagtgtaca tacaagctaa agaacaatta
     601  ttaaagaagc gaggggctga tgaggtcgca gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga