Sequence of DPV Unnamed TGP carmovirus 3

TGP Carmovirus 3 isolate 08TGP00078 putative RNA-dependent RNA polymerase and putative replication associated protein genes, partial cds; and putative movement protein 1, putative movement protein 2, and putative coat protein genes, complete cds.

ACC No: JF437874

Dated: 2011-03-23 | Length: 3187 | CRC: -896265191

                
ID   JF437874; SV 1; linear; genomic RNA; STD; VRL; 3187 BP.
XX
AC   JF437874;
XX
DT   23-MAR-2011 (Rel. 108, Created)
DT   23-MAR-2011 (Rel. 108, Last updated, Version 1)
XX
DE   TGP Carmovirus 3 isolate 08TGP00078 putative RNA-dependent RNA polymerase
DE   and putative replication associated protein genes, partial cds; and
DE   putative movement protein 1, putative movement protein 2, and putative coat
DE   protein genes, complete cds.
XX
KW   .
XX
OS   TGP Carmovirus 3
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-3187
RG   Plant Virus Biodiversity and Ecology Consortium
RA   Scheets K., Blinkova O., Melcher U., Palmer M.W., Wiley G.B., Roe B.A.;
RT   "Detection of members of the Tombusviridae in the Tallgrass Prairie
RT   Preserve";
RL   Unpublished.
XX
RN   [2]
RP   1-3187
RG   Plant Virus Biodiversity and Ecology Consortium
RA   Scheets K., Melcher U., Blinkova O., Palmer M.W., Wiley G.B., Roe B.A.,
RA   Dutta M.;
RT   ;
RL   Submitted (22-FEB-2011) to the EMBL/GenBank/DDBJ databases.
RL   Biochemistry & Molecular Biology, Oklahoma State University, 246 NRC,
RL   Stillwater, OK 74078, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3187
FT                   /organism="TGP Carmovirus 3"
FT                   /host="Ambrosia psilostachya"
FT                   /isolate="08TGP00078"
FT                   /mol_type="genomic RNA"
FT                   /country="USA"
FT                   /lat_lon="36.8 N 96.42 W"
FT                   /collection_date="16-Jun-2008"
FT                   /db_xref="taxon:944582"
FT   CDS             <1. .1691
FT                   /codon_start=3
FT                   /transl_except=(pos:117. .119,aa:OTHER)
FT                   /product="putative RNA-dependent RNA polymerase"
FT                   /protein_id="ADZ73441.1"
FT                   /translation="VDNVWLYFISHPWKGKAWRNVVLRALGMPPQEAYEFAKXGCLMHT
FT                   CGVDTKVFRGEHHWVKEGHEARSIPPRKLYNIAGVGPNIHWGVHNSSYVNLRRGLMERV
FT                   YYVERQGKLAQCPTPTAGIFKRLFTKYGHRIAGLCGNHSKVSREDFVGSYCGRKRTIYA
FT                   NAVASLDERPLLRRDSFLSTFVKCEKLNFSKKPDPAPRVIQPRDPRYNVELGVYLKRFE
FT                   HSAYRALDKMWGEPTVMKGYTVEQMGKILSDKWNKYQTPVAIGFDMSRFDQHVSVDALK
FT                   FEHKIYKTVYKGDGLLAKLLDWQLDNRGTAFAKDGWLKYRVEGKRMSGDMNTALGNCIL
FT                   ACTITKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYGFTCVAELPVR
FT                   VLEKVEFCQMQPVLRNGGYVLVRNPRVSISKDCHSTTPFDSVRLAQEWAYSIGVGGISL
FT                   THGIPLVQEFYTMLMRNGKKHQSLKKEMLFYGDYYASWVKIHKGEYEPVTEESRHSFHL
FT                   AFDISPDQQVAMEDELKQMALEWEFAPFSRIANSTEWTLNQPIKI"
FT   CDS             <1. .119
FT                   /codon_start=3
FT                   /product="putative replication associated protein"
FT                   /protein_id="ADZ73440.1"
FT                   /translation="VDNVWLYFISHPWKGKAWRNVVLRALGMPPQEAYEFAK"
FT   gap             1042. .1162
FT                   /estimated_length=121
FT   CDS             1661. .1846
FT                   /codon_start=1
FT                   /product="putative movement protein 1"
FT                   /protein_id="ADZ73444.1"
FT                   /translation="MDAQPTNQDLAKKDQTAKRGKTKNRLDVAHSGVSKGTSRDLVGAN
FT                   FVAVADTITYHVTLNF"
FT   CDS             1752. .1991
FT                   /codon_start=1
FT                   /product="putative movement protein 2"
FT                   /protein_id="ADZ73443.1"
FT                   /translation="MASARVHLGTLSVLILLQLLIRSPITLRLTFDFDPSPNLLSSIVL
FT                   SIFFVSVLGNSGSVHYYYQANSTADKFISVAVGK"
FT   CDS             1988. .3001
FT                   /codon_start=1
FT                   /product="putative coat protein"
FT                   /protein_id="ADZ73442.1"
FT                   /translation="MTAGASPITLSYAAQGHAWAIKLRDKGWRSLSPAQKKAARAAGIG
FT                   PQPTPVIVPKVNRLVAGNPTNARRKPTDPGNANTSMTITKQEFLGTLFSGDEISTYILD
FT                   PRNVKTFPNISNMAIGYNKYKITNAKLRYSSRATDSDCSIIIAYNSDSSDTPPASKLDL
FT                   YSMATKHEGPSSKPLLMSLPISKETRYLRDRNTDEAKLVDSGSFHILVDGKHDGRLGEL
FT                   FFELTIVLSEPTFLRPASQIITGTSSRGPDIVTVDRGNTSCTIRFNAVGRFIISASGTS
FT                   IKKLSQVGMEKASLSRTDSDSDSTFIAEVIASEPGASIIVEYPSGGYNQKVYVSRM"
XX
SQ   Sequence 3187 BP; 843 A; 709 C; 785 G; 728 T; 122 other;

jf437874 Length: 3187  23-MAR-2011  Type: N  Check: 3868  ..

       1  cggtggacaa cgtatggctc tactttatca gccacccatg gaagggcaaa
      51  gcgtggagga atgtagtact gcgggcttta ggtatgcctc cccaagaggc
     101  atacgagttc gccaaatagg ggtgcctcat gcacacctgt ggtgttgaca
     151  cgaaagtgtt tagaggggaa caccactggg ttaaggaagg gcatgaggcc
     201  cgtagcatcc ctcctaggaa actatataat atagcaggtg tgggtcccaa
     251  tatccattgg ggagtacaca atagtagtta tgttaatctt aggcgcgggt
     301  tgatggagag agtttactac gtcgaaagac aaggtaaact tgcccaatgc
     351  cccaccccta ctgcggggat atttaaacgg ctgttcacca agtatggtca
     401  caggatagct gggttgtgtg gaaatcattc caaggtctcc cgcgaagact
     451  tcgtgggatc gtactgcggc aggaagcgca cgatctatgc caatgctgtg
     501  gccagtcttg atgagcgccc gttactacgc agagatagtt ttcttagtac
     551  ttttgtaaaa tgcgagaagt tgaactttag caagaagccg gacccagctc
     601  caagagtgat acaaccccga gatccgcgtt ataacgtgga gcttggggtc
     651  tacttaaaga ggttcgagca ctctgcttat agagcgttag ataagatgtg
     701  gggtgaacct accgttatga aagggtacac cgttgagcaa atgggaaaga
     751  ttcttagtga caagtggaat aagtaccaga caccagtggc aataggcttt
     801  gatatgagta gatttgatca gcacgtgtct gtggatgccc taaagttcga
     851  gcataaaatt tacaaaacag tctacaaagg ggatggtctc ctggccaaac
     901  tcctggactg gcagctcgac aatcggggaa ctgccttcgc caaagatgga
     951  tggctcaaat acagagtgga aggcaaaagg atgagtggag acatgaacac
    1001  tgcccttggg aattgcattt tggcttgcac tatcaccaaa gnnnnnnnnn
    1051  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
    1101  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
    1151  nnnnnnnnnn nnatatggat ttacatgtgt cgctgagctc cccgttagag
    1201  tactggagaa ggtggaattt tgccaaatgc agcccgttct cagaaatgga
    1251  ggatacgtac tagtccgcaa ccccagggtc agcatatcta aagattgcca
    1301  ctctaccact ccgttcgact ccgttcggct agcgcaggag tgggcttact
    1351  ccatcggtgt gggggggatc agtttaaccc acggcatccc acttgtacag
    1401  gaattctaca ctatgctcat gcgtaacggg aagaagcacc agagccttaa
    1451  gaaagaaatg ttattctatg gcgactacta tgccagctgg gtaaaaattc
    1501  acaaaggcga gtatgaacct gtaacggaag aaagccgtca cagtttccac
    1551  ttggcttttg atattagccc agatcaacaa gttgccatgg aagatgagct
    1601  caaacagatg gctctggagt gggagttcgc cccattcagt agaattgcca
    1651  attctactga atggacgctc aaccaaccaa tcaagatcta gcaaagaaag
    1701  accaaacagc taagcgtggt aagacaaaga atcgattaga cgttgctcat
    1751  tctggcgtca gcaagggtac atctagggac cttgtcggtg ctaattttgt
    1801  tgcagttgct gatacgatca cctatcacgt tacgcttaac ttttgatttt
    1851  gatccttccc ccaacttact aagctctata gttctcagca ttttctttgt
    1901  ttcagtttta ggaaatagtg gtagtgtgca ttactattac caggcgaaca
    1951  gtacagcaga taaattcatc tcagtcgcag taggaaaatg accgcaggtg
    2001  ctagtccaat aactctgagt tacgctgccc aaggtcatgc ttgggcgatt
    2051  aagctgaggg acaaaggttg gcgtagtttg agtcctgccc aaaagaaagc
    2101  tgcacgcgca gctggaattg ggcctcagcc tacccctgtc attgtcccga
    2151  aggttaatcg ccttgttgct ggtaacccca cgaacgctag gcgaaagcct
    2201  accgaccctg gaaatgccaa cacaagcatg accataacaa agcaggagtt
    2251  ccttggaacc ctgttcagcg gcgacgaaat cagcacctac atcttggacc
    2301  cccgaaacgt aaagactttc cccaacataa gcaacatggc cattgggtac
    2351  aacaagtaca agatcaccaa tgccaagctt cggtattcca gccgagccac
    2401  agacagtgac tgctcaatca tcattgcata caacagtgac agcagcgaca
    2451  ctccaccggc ttcgaagctt gatctctaca gcatggccac aaagcatgaa
    2501  ggtcccagca gcaagccatt acttatgagc ttgccgataa gcaaggagac
    2551  taggtacttg cgagatcgta acacagatga ggcaaagttg gtggatagtg
    2601  ggagttttca catcctcgtg gatggtaagc acgatggtcg cctcggagaa
    2651  ttgttcttcg agttgaccat tgtgctctct gaacccactt tccttcgacc
    2701  cgcctcacaa atcattacag gtaccagctc ccgaggacct gacattgtga
    2751  cagtcgacag aggcaatact tcctgcacta tacggtttaa tgccgtaggt
    2801  aggtttatta tctctgcaag cggcacttcc atcaagaaac tgtcacaagt
    2851  tgggatggag aaagcaagcc tatccaggac agactccgac agcgacagca
    2901  cgttcattgc tgaggtgata gcttcagaac ctggcgctag tataatagta
    2951  gagtatcctt ctggtggtta caaccagaag gtttatgttt ctagaatgta
    3001  aggggcacta gcccctccca ctgggangcc atgccccatg aattgacatg
    3051  ggtgggtggg tactatgtac attatgtgtg tagtgtatac ctttggaggt
    3101  gctgaaccta agtctagggg atgtgtctcg tgcctggtgc gccaacacca
    3151  ggcgaggctc tagacggtgc gggatgaaat ctggagg