Sequence of DPV Unnamed TGP carmovirus 1

TGP Carmovirus 1 isolate 06TGP01062 putative RNA-dependent RNA polymerases, putative movement protein 1, and putative movement protein 2 genes, partial cds; and putative coat protein gene, complete cds.

ACC No: JF437885

Dated: 2011-09-04 | Length: 3057 | CRC: 589844652

                
ID   JF437885; SV 1; linear; genomic RNA; STD; VRL; 3057 BP.
XX
AC   JF437885;
XX
DT   23-MAR-2011 (Rel. 108, Created)
DT   04-SEP-2011 (Rel. 110, Last updated, Version 2)
XX
DE   TGP Carmovirus 1 isolate 06TGP01062 putative RNA-dependent RNA polymerases,
DE   putative movement protein 1, and putative movement protein 2 genes, partial
DE   cds; and putative coat protein gene, complete cds.
XX
KW   .
XX
OS   TGP Carmovirus 1
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-3057
RX   PUBMED; 21762736.
RA   Scheets K., Blinkova O., Melcher U., Palmer M.W., Wiley G.B., Ding T.,
RA   Roe B.A.;
RT   "Detection of members of the Tombusviridae in the Tallgrass Prairie
RT   Preserve, Osage County, Oklahoma, USA";
RL   Virus Res. 160(1-2):256-263(2011).
XX
RN   [2]
RP   1-3057
RG   Plant Virus Biodiversity and Ecology Consortium
RA   Scheets K., Blinkova O., Melcher U., Palmer M.W., Wiley G.B., Roe B.A.;
RT   ;
RL   Submitted (01-MAR-2011) to the INSDC.
RL   Biochemistry & Molecular Biology, Oklahoma State University, 246 NRC,
RL   Stillwater, OK 74078, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3057
FT                   /organism="TGP Carmovirus 1"
FT                   /host="Melilotus officinalis"
FT                   /isolate="06TGP01062"
FT                   /mol_type="genomic RNA"
FT                   /country="USA"
FT                   /lat_lon="36.85 N 96.41 W"
FT                   /isolation_source="upper leaves"
FT                   /collection_date="02-Jun-2006"
FT                   /db_xref="taxon:944580"
FT   CDS             <1. .>224
FT                   /codon_start=1
FT                   /product="putative RNA-dependent RNA polymerase"
FT                   /db_xref="GOA:F2YSA8"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="UniProtKB/TrEMBL:F2YSA8"
FT                   /protein_id="ADZ73471.1"
FT                   /translation="TYLYGARLTNGLKIGVHRNDFPNLRRGVMERVYYVENSETKQLQS
FT                   PITPVDGIYRSMKYIRLKLGGYIGLHSRTP"
FT   gap             225. .1263
FT                   /estimated_length=1039
FT   CDS             <1264. .1467
FT                   /codon_start=1
FT                   /product="putative RNA-dependent RNA polymerase"
FT                   /db_xref="GOA:F2YSA9"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="UniProtKB/TrEMBL:F2YSA9"
FT                   /protein_id="ADZ73472.1"
FT                   /translation="KGMGGRTRGTHSISERTRYSFYLAFGITPDEQRAFEDDWERETIV
FT                   WEWAPDGFVAANHACLQLISQS"
FT   CDS             1440. .>1534
FT                   /codon_start=1
FT                   /product="putative movement protein 1"
FT                   /db_xref="UniProtKB/TrEMBL:F2YSB0"
FT                   /protein_id="ADZ73473.1"
FT                   /translation="MSTVDKPIIEVGLPQTNIVEDTATKRGRTKNG"
FT   gap             1535. .1652
FT                   /estimated_length=118
FT   CDS             <1653. .1779
FT                   /codon_start=2
FT                   /product="putative movement protein 2"
FT                   /db_xref="UniProtKB/TrEMBL:F2YSB1"
FT                   /protein_id="ADZ73475.1"
FT                   /translation="NRVIALALLGAVLTSVGNSSTVYYINNSTNENKTNHIKIET"
FT   CDS             1776. .2816
FT                   /codon_start=1
FT                   /product="putative coat protein"
FT                   /db_xref="GOA:F2YSB2"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:F2YSB2"
FT                   /protein_id="ADZ73474.1"
FT                   /translation="MNGISQNDPKVVKAAEAGIPWAIKLRSRGWRSLRTNQKXXERAFV
FT                   GSSAPSVAIVPRVARLVRGNPQRTRRNPQQPGNAADSTTITKSDFVADVIGNTTEAGTV
FT                   TSWLINPSNXVAFPSLLNESARWEKYKITKFSIRFSSKCSEYTDGGVVVQFASDSTDAV
FT                   PTSKYGIMQSQCRADASAHGSVLLNCXVDTGVRFVRDSSADSGKVVDYGRVNLCAYGQK
FT                   AADPSIIGELFFEYTIVFSEARVNRGVTQYQYLLTDSVDGPSFASVTSTSAELTFTFNL
FT                   PGKYTFICSFTGTVSGLYAADLTYDWSVDNTTAVAGVVTVTSPGATLXWAIGATVTSLL
FT                   WQCNIF"
FT   gap             2832. .2947
FT                   /estimated_length=116
XX
SQ   Sequence 3057 BP; 470 A; 419 C; 467 G; 419 T; 1282 other;

jf437885 Length: 3057  04-SEP-2011  Type: N  Check: 5938  ..

       1  acttacctgt acggcgcacg attgacgaat ggcctgaaga ttggggtgca
      51  tcgcaatgat tttcccaacc ttcggcgagg cgtcatggag cgcgtgtact
     101  atgtagaaaa cagtgaaaca aaacaattgc agagccctat aacacccgtc
     151  gatggtattt accggagcat gaaatacatc cgtctaaaac tcggaggata
     201  catcggtctt cattccagga caccnnnnnn nnnnnnnnnn nnnnnnnnnn
     251  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
     301  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
     351  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
     401  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
     451  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
     501  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
     551  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
     601  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
     651  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
     701  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
     751  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
     801  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
     851  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
     901  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
     951  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
    1001  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
    1051  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
    1101  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
    1151  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
    1201  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
    1251  nnnnnnnnnn nnnaaaggga tgggaggacg aacccggggc acacacagca
    1301  taagtgaacg gacccgatac agcttctatc tggcgtttgg aatcacccct
    1351  gatgaacaac gcgcatttga agacgattgg gaaagggaaa ctattgtctg
    1401  ggagtgggcc cccgacggat ttgttgccgc aaaccacgca tgtctacagt
    1451  tgataagcca atcatagaag taggtctacc gcaaactaac atagtagaag
    1501  acacagcaac caagcgaggt aggacaaaga acggnnnnnn nnnnnnnnnn
    1551  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
    1601  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
    1651  nncaaccgtg taattgctct agccctcttg ggcgctgtat taactagcgt
    1701  aggtaattct agcaccgtat attacattaa taatagtacc aacgagaaca
    1751  agacaaacca catcaaaatt gagacatgaa cggcatttca caaaatgatc
    1801  ctaaagttgt taaggctgcg gaagctggaa taccgtgggc tattaaactg
    1851  cgttctcgcg gttggcgtag tctgcgtact aaccagaagt nnncagaacg
    1901  cgcttttgtg gggtctagtg ctccgagtgt tgctattgtc ccacgagttg
    1951  ctcgactcgt tcgaggtaac ccgcaaagga ctcgtcgcaa tcctcaacaa
    2001  ccaggcaacg ctgctgacag tactacgatc acaaaatcag actttgtcgc
    2051  agacgttatc ggcaatacaa cagaggcagg aaccgtcacc tcatggctga
    2101  tcaatccatc aaacgnngtg gcgtttcctt cattactcaa tgagagcgcc
    2151  cgctgggaga agtacaagat cacgaagttc agcattaggt tcagttcgaa
    2201  atgcagcgaa tacaccgatg gaggtgtggt tgtccagttc gcgtcggata
    2251  gtacagacgc cgttccaacg agcaagtacg gcattatgca gtcgcagtgt
    2301  cgagcagatg caagcgccca cggctcagtg ctccttaact gtnctgttga
    2351  taccggngtg cggtttgtgc gagactctag tgcggatagt gggaaagtcg
    2401  ttgactacgg tcgcgtcaat ctttgtgcgt atggtcagaa agcagcggat
    2451  ccttctataa taggtgagct gttctttgag tacaccatcg tgtttagtga
    2501  ggcgcgggtg aatcgcggcg tcactcaata tcagtacttg ctgactgaca
    2551  gtgtcgacgg gccgtcgttt gcgagcgtca cgagcacgtc tgctgagctg
    2601  acattcacat tcaatctgcc tggcaaatac acgttcatat gttctttcac
    2651  cggaacagtg agcgggttgt atgctgcaga tctaacatat gactggagcg
    2701  tagataacac cactgcagtg gctggtgtcg taacggtaac atcgcctggc
    2751  gcaacacttn gttgggccat tggagcaact gttacgagcc tgttgtggca
    2801  gtgtaacatc ttttagagta gactattcgg gnnnnnnnnn nnnnnnnnnn
    2851  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
    2901  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnacg
    2951  ctggagaacg tacctgcnta aaatcttgga gctggaccaa gtgggcttgt
    3001  taggtactcc ctagactttg tcttaaaggg aaccgtgtga ctcggttctc
    3051  cttgccc