Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate B301, complete genome.

ACC No: JF957196

Dated: 2011-08-14 | Length: 19255 | CRC: 1100651831

                
ID   JF957196; SV 1; linear; genomic RNA; STD; VRL; 19255 BP.
XX
AC   JF957196;
XX
DT   14-AUG-2011 (Rel. 109, Created)
DT   14-AUG-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate B301, complete genome.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-19255
RA   Roy A., Choudhary N., Hartung J.H., Brlansky R.H.;
RT   "Trifoliate resistance breaking (RB) Citrus tristeza virus genotype
RT   specific RT-PCR and complete genome sequence analysis of an unassigned
RT   isolate discovered the presence of RB genotype from Puerto Rico";
RL   Unpublished.
XX
RN   [2]
RP   1-19255
RA   Roy A., Choudhary N., Hartung J.H., Brlansky R.H.;
RT   ;
RL   Submitted (12-MAY-2011) to the INSDC.
RL   Plant Pathology, Citrus Research and Education Center, University of
RL   Florida, 700, Experiment Station Road, Lake Alfred, FL 33850, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .19255
FT                   /organism="Citrus tristeza virus"
FT                   /host="sweet orange cv. Madam Vionus"
FT                   /isolate="B301"
FT                   /mol_type="genomic RNA"
FT                   /country="Puerto Rico"
FT                   /collected_by="Dr. S. M. Garnsey"
FT                   /collection_date="1992"
FT                   /note="genotype: resistance breaking"
FT                   /db_xref="taxon:12162"
FT   5'UTR           1. .107
FT   CDS             108. .9458
FT                   /codon_start=1
FT                   /product="p349 protein"
FT                   /note="polyprotein; contains papain like leader protease I
FT                   and II, methyltransferase, inter domain region and helicase
FT                   like domains"
FT                   /protein_id="AEL99958.1"
FT                   /translation="MSKLRGSFWSSAFAASSEYTISRIWRKLNTIVVLHYFGSVRITKV
FT                   IRDKSANMPIVPLRKSVFPFSVRAAVRAIRAAGRPLDAPHSGCLCGNPVINASGVVRPR
FT                   SVAGFSRFSLRKPPLSSAAKKSIRQAKRESVSPFSRASSLFSREVPRGTRSKLRRRVVR
FT                   RTDTTLPESPQDKPIRQNRRLGKASHLPYMGEAALDDILRWIEGVNPHPSMVAIPVPIA
FT                   FGTMPATAWCSKSDAAVLRCRLNYHAAETDFSTQEKHVRYVYNDVSSAANRPRTVSSRK
FT                   CGSVFPSKSKLGVEVPSGRDVHTAFVRSSHASAFFSDAVRRVRLFRPARNNFFTSVVSG
FT                   RRVCYYRPGPCGTVSVFMSDGVNTARLDVVAPAYYAYAKSLGAKARFLWESSDLDDAKI
FT                   RDGQCYIRHVFDVALYFGRRADFSVRRALGLYPTVGALKAYLVREYGRDSLKVPMRGTY
FT                   TFGSVFHCLSTESSVDLRSIPNHHLVGGTSAHVLIGQIRVNVPGSTSKPSRSAVRRRNR
FT                   RMRRDGYLGSSGSSSFIGESNYCSDCSSPRSTPSPSILKPSLGRVPSMDQRFRFPAGTQ
FT                   LRVSVPRRVDDHVYVSTGQNFDELCHAVCTYVKRYNSRKSFYTRFESGRDYIVLRRASV
FT                   GGLHVFVKRGNFTARFPISAVRYENHYAATMMDDGIGWVPKGHVPDVEIVKRRRSRNRR
FT                   LPLSHRVAEQSVPALPSSSVEAASASSDRSSSSEKASTPSCDSERSSDWVNVGYSRQTT
FT                   TKVRESRFTGRGKIGNFTFPRGTVYNTPVDECAYKRVLKLRDTTACSFLRILLARLSSY
FT                   RPLSDDFFNKCVTSRFVACIEPVESGLVKVHFRSDVFRASFPFGVNLYTRHAFDIGSGS
FT                   LLNLDTYGFSESLKEGYCYIRHFAEVSLSMGRIFFRRDVDLGPFPYVFEVQHRLERLYG
FT                   KAASRYGVRGHYSASRYFHCCYDDSPKPLASFNKYHRMGGEDNSLIITDTDRLRAVGSA
FT                   YEKVKRNIPDSLLIRSVEKDLIEFNQTLVDMHRSRPGVVVPFQMSENQQVMLTRAYPEF
FT                   NINFIHSVHSDHPVAAGSRALENHLVRKHAGTDYSDVGGCPLFHLRAGHSGVHVCRPVY
FT                   DVKDAHRRVVRHHQLNKVSLDQSDGVKQVGAVNTNSVCGNTLGECYHVSEAIVMVQVYD
FT                   VPLHELCRAMINKKASVCYMTMVTPGELLDARESFFIKDLDCSVELDPVADQVVYCFNN
FT                   SAYTHTYSTICEYMRTPCLVVDGFLFTIEMVSLRCSVNYYCITKSSVCPRISETKRLRY
FT                   RRCDSDLIRIKIPRYSSRTRSCLPGCYYLYLDAKFVSRVYEYVVNNCVVVNAKTFEWTW
FT                   NYIKSCKSRVVISGKIIHRDVPIALEYLDGFSAVMLSAGVKGRQNAEAFSRRLAAFSGE
FT                   TSIFELVRFAISEKCRDLFMGIQDAVERCVKSYLRNSFNMSFVDLSDPLLTISEYSELD
FT                   VPINLPGFGRIVDGDETRLMEDGIKSALLRKAVRDEAQLSLKRGNTSEIVPCEDDDDSN
FT                   GDDSRVSRDSDGGSSSGGSSGGLRAGAAPSLFRRLLRKLGGGLCLAKKVLELLLKRVVE
FT                   SFSRLKRKTTRLTSFANLLLARLSCGFFDDSVFSAVWEIAVNLTRIVDGVVKTKLECFR
FT                   NLFRLIPKLYIGCRDVVKDVSNAYRSAVLFSAEIFGKSYSKLCQFCLETFDVGLIEISA
FT                   RNLGLETCVSMAQAIFDVLVAFPLGSVSFSVVCARVFGALAMEVGSNFLFKKVFGKPET
FT                   LGEDAFRRTVSMVLSAKAFDKLSVDAKGLVRCSGVIPGVLRIILSSLFSEADAWVGYSK
FT                   HEVSSLPIVTFCVKKLSYSLERCKEACITFVVDSAKKILKSLTSEFNESIQNSDLTSGA
FT                   KSLYGHVSSILSTSSGVINKAGNAVATVKAVGSDIGGRVKRLRPRFSLSRHFDEQTSEY
FT                   YSASDCSELDESLLSETPGLRGNGRCRDLFRIVSRRAVACSEYLINLLKQLTSRASEYS
FT                   YSYVMDLLVRLYVATDDVVRRCRSFTFDCTDKASNFFVGCLSWYNLRSGAYSATPGLGG
FT                   GSRSLTTVFPTGGFVRVIGVLWNVLSVVFDEEFFRTLLHRLRTDVVVFLVEFLKNLPVS
FT                   LFSVYTFIECRGRIFPLREFLRGFCRFVWEIVEGLSINVYQLLSAVVVKAYRSAFSHRF
FT                   SEEDERTLRVITEAEGRIEFLRVVLAEMERFHAASNEMSLSRSSDSPSFPPTYGEIVEL
FT                   NDDSSDSALVIGVDDGTGRAIVDRETDSASGSDSDVSIPLDRDFEQIGGLGGNGNVDVF
FT                   RLGLRFTLKLLRNLFNARSFKVLYGLLLQTLFYGNSVNKFVSRLVFSLGTCIPFELFRF
FT                   ACSARRLFKSLASFVHQTSLFSEATVEPLFSFSRLLYDSRYFSSVFSEIERFDFYLDHF
FT                   LSLPKRYLFPNFRFRGCARAPVLVTRTEEVTPVCKRSLNDILDSLDSLKVSDLKGKSTF
FT                   VDDGESDSGSELSGSSISFGSVNKEVLNAVNGDGVCERAPLMKHATALSKLEPDPSGRK
FT                   DIPVSKKTFTRGECSGVKSKVGMCDYLMTLNSSFGTVPDMYPVARDITYKKLTNAMREF
FT                   YYSQKITLYELHGKLSSYWDELKVAGFDRKLTRMDLDDDVYVVDFNRKLLVGRNGSHPF
FT                   RSTLKSYCFMFCNDGLVPCPGSQKYDYALISNQTSFVAANSFLRAVDGKDLTFTNEEHS
FT                   LIVYEAPPGGGKTHSLVNCYADYCDKVSCLVVTANKNSQTEISQRISSELMSRKRAAKY
FT                   VTGAASRVFTVDSYLMNHLRLTTQLLFVDECFMVHAGAIGAVVEFTSCKAVVFFGDSKQ
FT                   IHYIHRNDFGVSLLHDIDAFIQPEHRVYGEVSYRCPWDICEWLSEFYPRHVATANVGSV
FT                   GKSSVSIEEINGCDDVPYDKAAKYIVYTQAEKNDLQKHLGRLTVGRTKVVPIVNTVHEV
FT                   QGETYKRVRLVRFKYQEDTPFSSKNHIVVALTRHVDSLVYSVLTSRRYDDTATNIDRAK
FT                   EIFDKFRSTNHSYGSSSLEWYLEKFPTEYKGSKASSAPISCINEFLNEVVVGSSIVQLG
FT                   DVSEELSSRPFESGCDNVTVRDTAPPDSGNLHEPARVRRSKVASNSSKKSVATRKPSVV
FT                   RKS"
FT   CDS             <9382. .10815
FT                   /codon_start=1
FT                   /product="RNA-dependent RNA polymerase"
FT                   /note="p54; start codon not determined; ORF1b; expressed
FT                   through +1 ribosomal frameshift from ORF1a"
FT                   /protein_id="AEL99959.1"
FT                   /translation="GVVRSQAIPPRKASLQENLLSYESRNYNFIKTERFVGPSEFGRAM
FT                   AAAVIERCFKMEEMAKIRCDIISLTEANILKWLDKRTPCQIKAVQAELKLPFSVEEQIT
FT                   NYKLMVKRDAKVKLDDSSLSKHPAAQNIMFHKKFINAIFSPCFDEFKNRVLSSLNDNIV
FT                   FFTEMTNAGLAEVIRRIVGDDDNLFVGEVDFSKFDKSQDLFIKEYERTLYSEFGFDTEL
FT                   LDVWMEGEYRARATTLDGQLSFSVDGQRRSGGSNTWIENSLVTLGILSLYYDVSKFELL
FT                   LISGDDSLIYSSEKISNFSSEICLETGFETKFMSPSVPYFCSKFVVQTGNKTCFVPDPY
FT                   KLLVKLGAPQNKLTDDELFELFTSFKDITQDFGDQVVLEKLKLLVEAKYGFTSGTTMPA
FT                   LCAIHCVRSNYLSFERLFPFIRGWYVVDALKLRQLRRFANLICERIVYDNRVGYFSYFD
FT                   NPFTKPDASDGQMDDLVTS"
FT   CDS             10864. .11775
FT                   /codon_start=1
FT                   /product="p33"
FT                   /note="ORF2"
FT                   /protein_id="AEL99960.1"
FT                   /translation="MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDVDDR
FT                   DPTVLADYFSLYFFLLNNDNVGPLSASIVVSPPVSGTYKIRAHVDNQPNCEGNVTYVKT
FT                   TNKSRFAILVKAVPAPMRGYYSFRAFLTDNVTSERSEFICSFISSRFLCCCTQTISENL
FT                   SKVCSSSFSFRAASETAINEFSVATDDVEDIKYVRKQAEGFSRCADPYPPRCYRGVSLG
FT                   DSSGVQSRTIEEEGYRTDTAGNVAVTIPNTPLVSAVSPYVAEYNENTRSRISLIRRVCC
FT                   YAVCVLVVSLLIMSGLLAIIFI"
FT   CDS             11845. .12000
FT                   /codon_start=1
FT                   /product="p6 small hydrophobic protein"
FT                   /note="ORF3; required for virus movement"
FT                   /protein_id="AEL99961.1"
FT                   /translation="MDCVIQGFLTFLVGIAVFSAFAGLIIIVITIYRCTTKPVRNASPY
FT                   GTHATV"
FT   CDS             12006. .13790
FT                   /codon_start=1
FT                   /product="p65 protein"
FT                   /note="ORF4; similar to HSP70h; involved in assembly of
FT                   virion"
FT                   /protein_id="AEL99962.1"
FT                   /translation="MVLLGLDFGTTFSTMAMAASSELVILKQSNSSYIPTCLFLHADPN
FT                   SVSYGYDAEYLAASGEPGSFYKDLKRWVGCTEKNYQSYLHKLSPSYKVIVKEFGAKSMP
FT                   VPYLSPLNNDLGLSVALPSLIALYTKSILSDAERVFNVSCTGVICSVPAGYNTLQRAFT
FT                   QQSVSLSGYSCVYIINEPSAAAYSTLPKLSSADKYLAVYDFGGGTFDVSIVSVRLPTFA
FT                   VRSSGGDMNLGGRDIDRKLSDKIYELADFLPQKELNVSSLKEALSLQTDPVKYTVTSYG
FT                   ISETVSIDQTTLREIASVFITRTIDILTQVKVKSSMPESQSLKLVVVGGSSYLPGLLDT
FT                   LETVPFVSGIIPVEDARTAVARGCALYSECLDGRSKALLIDCITHHLSVTTFSADSVVV
FT                   AAAGSPIPFEGEQKLTLRKCVSTSNYQARMFEGDYEKVFRNERIYAASVSLFTLGVNWR
FT                   LPNDVEMTLVTRVDSMGKVEFYLKGPSGELVNVQGTSHYDYVGMPHPTRKLLRLSDYNV
FT                   NSAALVLALTLTREKREKFLLRTLFDALLADLRKTASLSEYSKKYPITRNDVDVVSSRM
FT                   GIVVSKVLRGSDLERIPL"
FT   CDS             13714. .15321
FT                   /codon_start=1
FT                   /product="p61 protein"
FT                   /note="ORF5; involved in assembly of virion"
FT                   /protein_id="AEL99963.1"
FT                   /translation="MSSHHVWGSLFRKFYGEVIWKEYLSESTRNFDERNVSLDHTLSSG
FT                   VVVRMQSLLNAPQGTFENELALLYNSVVINDFVEFTGMPLKSLMTSIEDRKVPDELISV
FT                   DPHEVGCKFTLNDVESYLMSRGEDSADATAVEHSWCLSNSCGRLLSSTEIDAYKTMVFT
FT                   KSFDSSVSGVITKLETYLSYCISLYKKHCMKDDDYFNLILPMFNCLMKVLASLGLFYEK
FT                   HTDNPLLTGMLIEFCLENKVYYSTFKVNLDNVRLFKSKVLPVVLTVWDISEPDDPVDER
FT                   VLIPFDPTDFVLDLPKLSIHDTMVVVGNQIRQLEYVVESDALDDLSQHVDIRLAADNPD
FT                   LRIDLRWAGMFVYYGVYRCAIDRVVERPTLFRLPLKLLSQDDGESCLLRMSAVEALFNL
FT                   VQKVNRDINVRRQFMGRHSKVALRLYRNLGLRFPPISSVRLPVHHGYLYVDFYKRVPDD
FT                   AVTADELESLRQLRSSVDVMCKDRVSITPPPFNRLRRGSSRTFRGRGARGASSRHMSRD
FT                   VATSGFNLPYHGGSYEAS"
FT   CDS             15296. .16018
FT                   /codon_start=1
FT                   /product="p27 minor coat protein"
FT                   /note="ORF6; required for virion assembly"
FT                   /protein_id="AEL99965.1"
FT                   /translation="MAGHTRLPNTDDKEMDPVSAAVPGKYPDVIEKFVTNRSVDALIEG
FT                   VISKLDTNSIYEDSTEKFTGEYLKYVMVTMDTFLLENYKTKTEDLLVHLAMIQKRLCTI
FT                   STSTKTKFRDKGCISYVQGGSRYKLMDKVVFPFIISKFTDRETPNALRKYACTFEELHL
FT                   CMARLRPDLYENKRTTKAGTPHLKGYLSADFLSGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATEFLNLRDLGKYL"
FT   CDS             16112. .16783
FT                   /codon_start=1
FT                   /product="p25 major coat protein"
FT                   /note="ORF7; required for virion assembly and plays a role
FT                   in supressor of RNA silencing"
FT                   /protein_id="AEL99964.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSMNLHIDPTLITMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLPDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFST
FT                   R"
FT   CDS             16749. .17252
FT                   /codon_start=1
FT                   /product="p18 protein"
FT                   /note="ORF8; may not have any function for citrus plant
FT                   infection"
FT                   /protein_id="AEL99966.1"
FT                   /translation="MSGSLGNLAHVDLLRSDSRFLSGWWSFIVNVGDIIVRFALHVPNE
FT                   DMLNNFSAISNCTIIADGSALLKDNTVVDRLEGMNPLAYLLNLAKTTTTICFTMSNKVL
FT                   FGTTKSEPLSCLAITSDRVLFKVIMGTNVDDSRCGCSIWFYNNGTFQNGLIRCDNLVAL
FT                   FSAT"
FT   CDS             17286. .17645
FT                   /codon_start=1
FT                   /product="p13 protein"
FT                   /note="ORF9; may not have any function for citrus plant
FT                   infection"
FT                   /protein_id="AEL99967.1"
FT                   /translation="MSFRRVWLKVMAVVTVLWYGKEPSISEGYNALMNDDFKFIDTHFS
FT                   NVSYAKKCYDLANFDLDFLRVVIIPLSGGTVNESRANPTNVSEIVESHMSDRDRMSILL
FT                   RNKRIQIPSLLPCGG"
FT   CDS             17721. .18269
FT                   /codon_start=1
FT                   /product="p20 protein"
FT                   /note="ORF10; forms inclusion bodies and play a role of
FT                   suppressors of RNA silencing"
FT                   /protein_id="AEL99968.1"
FT                   /translation="MRAYFSVNDYISLLAKVGAVVERLCDPSVTLTEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHQDGHHEMGEHKSRLLCNIEAKLRVLLDIIRRRFTREKLLCTSATD
FT                   VMGFFVVRYMSSSHTSFESVMHTELKLVVKAVLSDLSRTHKLDFSERAFAAYGILLQKG
FT                   AVATVCSQFDINLVSPSCV"
FT   CDS             18352. .18981
FT                   /codon_start=1
FT                   /product="p23 regulatory protein"
FT                   /note="ORF11; required for asymmetric RNA accumulation;
FT                   RNA-binding protein and play a role of suppressors of RNA
FT                   silencing"
FT                   /protein_id="AEL99969.1"
FT                   /translation="MDDTSGQTFVSVNLSDESNTASTRVENVKSEADRLEFLRKMNPFI
FT                   IDALVRKTNYQGARFRARIIGVCVDCGRKHDKALKTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAETFAIELVLYTKEKQLAVDLAAEREKARLARRHPMRSPEETPEH
FT                   YKFGMTAKAMLPEFNAVGVGDNEDTSSEYPVSLSVSGGVLREHHFI"
FT   3'UTR           18982. .19255
XX
SQ   Sequence 19255 BP; 4723 A; 3811 C; 4811 G; 5910 T; 0 other;

jf957196 Length: 19255  14-AUG-2011  Type: N  Check: 910  ..

       1  aatttccaaa attcaacctg ttcgcccaga aaatacgtct ggcgcaacag
      51  ggatccggaa taggtccagc ctttaagctc taatattccc acaacaaaaa
     101  ttacactatg tcgaaactca gaggaagctt ctggtcttcg gctttcgctg
     151  ctagcagcga atacacgata tcgcgcatct ggcgcaaact taacaccata
     201  gtagtcctgc actactttgg ttctgttaga atcaccaagg tgattcgtga
     251  caaatcggcc aatatgccga tagtccctct acggaaatct gtatttccgt
     301  tctctgttcg cgcggctgtt cgcgcaattc gtgccgctgg gcgtcctctc
     351  gacgctccgc attctgggtg cctctgtggc aatcccgtta tcaacgcatc
     401  tggcgttgtt cgtccccgct ctgtcgcggg tttttcgagg ttttctctgc
     451  gcaaacctcc cctctcctcc gccgctaaga agtccatccg tcaggcaaag
     501  cgggaatctg tttccccttt tagccgggct tcttctctct tctctaggga
     551  agtccctcgc ggcacacgtt ctaaacttcg aagacgtgta gtgagaagaa
     601  ctgacaccac cctacctgag agtccccaag acaagccgat ccgacaaaac
     651  cgccgacttg gtaaggcttc tcacctccct tatatggggg aggcagcgtt
     701  ggatgatatc cttcgctgga ttgaaggggt caatcctcat ccttcgatgg
     751  tcgctatccc agtgcccatc gctttcggaa ccatgcccgc aacggcgtgg
     801  tgttctaaat ctgatgccgc tgttttgcgg tgccgcttaa actatcacgc
     851  ggctgaaact gatttctcca ctcaggagaa acatgtgcgg tacgtctata
     901  atgacgtatc ttctgctgct aaccgtcctc gtacggtttc atcccgcaaa
     951  tgcgggtctg tttttcccag taaatctaaa ctgggcgttg aggtcccctc
    1001  tggtagggac gttcacactg cattcgtgag atcttctcac gctagtgctt
    1051  tcttctcgga cgcggttcgc cgcgttcgtt tgttccgccc tgcgcggaat
    1101  aattttttca cttccgtcgt cagcggacga cgtgtttgct actacagacc
    1151  cggtccttgt ggtacggtgt ctgtcttcat gtcggacggt gttaacacag
    1201  cacgtctcga cgtcgttgct ccggcgtact atgcgtacgc taagtctttg
    1251  ggcgccaaag cgcgcttttt gtgggagtcg tccgatttgg acgacgctaa
    1301  aattcgtgac ggtcaatgct atatccgtca cgtgttcgac gtggctctct
    1351  actttgggag acgcgccgac ttttctgtgc gtagagcact gggcttgtac
    1401  cccacagtgg gtgctttaaa agcttaccta gttcgcgaat atggtcgcga
    1451  ctctcttaag gttcctatgc gcgggaccta cacttttggc agtgtttttc
    1501  actgcttgtc gactgaatct tcagtcgacc tgcgatctat tcctaaccac
    1551  catttagttg gtgggacatc tgcccatgtc ttaattgggc aaattcgagt
    1601  caatgttcct ggctctactt ctaaaccctc acggtcggct gttcgtaggc
    1651  gtaacagacg catgcgacgt gacggttatc tcggtagttc cggttcttct
    1701  tcttttatag gggaatcgaa ttactgctcg gattgctctt ctcctcgcag
    1751  tacaccatct ccttccattt tgaaaccttc cctaggtcgg gttccgagca
    1801  tggatcagcg gttccggttt cctgcgggta cgcagctgcg tgtttccgtg
    1851  cctaggcgag tcgatgacca tgtttacgtg tcgaccggtc aaaactttga
    1901  tgagttgtgc catgcggttt gcacatacgt caaaaggtac aactctagga
    1951  aatcctttta tacacgattc gagagtggta gagattacat tgttctgcgg
    2001  cgtgcatccg ttgggggcct tcacgtgttt gtgaagcgtg gtaactttac
    2051  tgctcgattt cctatttcag cagtcaggta tgagaatcac tacgccgcaa
    2101  ctatgatgga tgatgggatt ggttgggttc cgaagggtca cgttcccgat
    2151  gttgagatcg tgaaacgtcg gagaagtcgt aatcgtcgtc ttcctctatc
    2201  ccatcgtgta gcggaacaat cggtcccagc gttaccatcg agttccgttg
    2251  aggctgcttc ggcttcgagt gataggtctt catcatcaga gaaggcttct
    2301  acaccttcat gtgactcgga aaggagttcg gattgggtga atgttggcta
    2351  ctctcgccaa actactacta aggttcgtga atcgcgtttt accggtcgtg
    2401  gtaagatagg aaattttact ttcccgagag gcactgtgta caatacacct
    2451  gttgatgaat gtgcctataa acgtgttctt aagttgcgag atactacagc
    2501  ctgttccttt ctccgcatac tgctagctcg tttgtcgagt tacaggcctt
    2551  tgagtgatga cttctttaat aagtgtgtca cttctcgatt tgtcgcgtgt
    2601  attgaacctg tggaatcagg tctagttaaa gtgcacttcc gttctgatgt
    2651  tttccgcgct tctttcccgt ttggggttaa tctgtatacc cgccacgcgt
    2701  ttgacattgg aagtggtagt cttttgaatt tggatactta tggtttttct
    2751  gaatccctga aggagggata ttgctacatt cgccatttcg ccgaagttag
    2801  tttgagcatg gggcggattt tcttcaggag ggacgttgac ttgggacctt
    2851  tcccttacgt tttcgaagtg caacaccgtc ttgaaaggtt gtacgggaaa
    2901  gctgcgtcaa gatatggtgt tagaggtcac tactcagcct cgcgctactt
    2951  tcactgttgc tacgatgatt cgccgaaacc gttggcttcc tttaataagt
    3001  accataggat gggcggtgaa gataactcac tgataatcac ggacaccgac
    3051  aggttgcgtg ctgtggggag tgcttatgaa aaggtgaaaa gaaatatacc
    3101  cgattcgtta ttgattcggt ctgtggaaaa ggacctcata gagtttaatc
    3151  agactctggt tgatatgcat cgatccagac cgggtgttgt cgtacctttt
    3201  caaatgagtg agaaccagca agtaatgctc actagggcgt acccagagtt
    3251  taatattaat tttattcact ccgtacattc cgatcatccg gtagctgcgg
    3301  gttctagggc gttggagaat catctcgttc gtaaacacgc tggtaccgat
    3351  tattcggatg tggggggttg tccgctgttt catttacgcg cgggtcactc
    3401  cggtgttcac gtttgtagac cggtgtacga tgttaaagac gctcaccgta
    3451  gagtagtccg tcatcaccaa cttaacaagg tttcgctaga tcagagcgac
    3501  ggtgttaaac aagttggtgc ggtaaacacg aactccgtgt gcggtaatac
    3551  tttgggagag tgttatcatg tatcggaggc gatagttatg gttcaagttt
    3601  atgacgtacc gctacatgag ttgtgtaggg ctatgataaa caagaaagct
    3651  tccgtgtgtt atatgaccat ggttacgcct ggcgagttgt tggatgcccg
    3701  tgagtccttt tttattaagg acttagattg ttcggtcgag ttggatcccg
    3751  tcgcggacca ggtcgtttac tgtttcaaca attccgcgta tacacacacg
    3801  tactccacta tatgtgagta tatgcgcact ccttgcttgg tggtggatgg
    3851  gtttttgttt actattgaaa tggtgtcgct caggtgtagt gttaattact
    3901  attgcatcac taaatcgtcg gtctgtccaa gaattagtga gactaagcgg
    3951  ttacgctacc gtcggtgtga cagcgacttg attagaatca agattccccg
    4001  gtactctagt agaacccgta gttgtttacc tgggtgttac tatttgtact
    4051  tggacgccaa gttcgtaagt cgcgtgtacg agtacgtggt caataactgc
    4101  gtcgtggtga acgcaaaaac ttttgagtgg acttggaatt acatcaaatc
    4151  ttgcaagtcg agagtggtga tcagcgggaa gattatacac cgagacgtcc
    4201  caatcgctct agagtactta gacgggtttt ctgctgttat gttgtccgct
    4251  ggtgtgaagg gtaggcaaaa cgcggaagcg ttttctagac gcttagccgc
    4301  tttttcaggt gaaacctcaa ttttcgagtt agtgaggttt gctatttccg
    4351  agaagtgccg cgacttattc atgggcattc aggatgctgt ggaaaggtgt
    4401  gtgaaatcgt accttaggaa ctcgtttaat atgagtttcg tggacttgtc
    4451  cgatccctta cttacgatta gcgagtattc ggagctggac gttcctatca
    4501  acttaccagg tttcggtagg atagtggatg gtgacgaaac tagacttatg
    4551  gaagacggta ttaaatcggc attattgcgg aaagcagttc gagacgaagc
    4601  acagttgagt cttaagagag gtaacacttc cgaaatcgtt ccgtgtgaag
    4651  acgatgatga ctcgaacggt gatgattcac gtgtttcgcg cgattcggat
    4701  ggtggttcgt cttcgggcgg cagttccggc gggttgcgag ctggagctgc
    4751  cccttctttg tttaggcgtt tactcaggaa gctgggtggg ggtttatgtt
    4801  tggcaaagaa agtgttggaa ctgttactca agcgggtggt tgaatcgttt
    4851  tcacgtctga aacgaaagac cactcgttta acgtctttcg ctaatttgtt
    4901  gcttgcgagg ctctcttgcg ggtttttcga tgattccgtt ttttctgcgg
    4951  tctgggaaat tgcggtcaac ctgaccagga tcgtcgatgg agtagttaag
    5001  acgaaattag agtgctttcg aaatttgttt cgattgattc ctaagttata
    5051  tatcggttgt agagacgttg tgaaggacgt tagtaacgct tacaggtcgg
    5101  ctgttttgtt ttccgctgaa atttttggta agagttactc taaactttgt
    5151  cagttttgct tggaaacgtt tgacgtgggg cttattgaga tttccgctcg
    5201  taatttggga ttagaaactt gcgtctcaat ggcacaggct atttttgatg
    5251  tgttggtcgc ttttcctttg gggagcgtta gtttttccgt cgtttgcgct
    5301  agggttttcg gtgctctcgc tatggaagtg ggatcgaact tcttgtttaa
    5351  gaaagttttc ggtaaacccg agactctagg tgaagacgcc ttccgtagga
    5401  ccgtgagtat ggttttgagc gccaaagcgt ttgacaagct ttccgtagat
    5451  gcgaaaggct tagttaggtg ctctggtgtt attcctgggg tgttaaggat
    5501  aatactatct tccttgtttt ccgaggcgga cgcttgggtg ggttacagta
    5551  aacatgaagt ttcttccctt cctatagtta ccttctgcgt aaagaaattg
    5601  tcttattctt tggagcggtg taaggaagcg tgtatcactt tcgttgtcga
    5651  ctctgctaag aagattctga aatctttaac ttctgagttc aacgaatcta
    5701  ttcaaaattc cgacttgact agtggtgcta agtctttgta cgggcacgtg
    5751  agctcgatac tttccacctc tagcggtgtg attaataaag ccggaaacgc
    5801  tgtcgctact gttaaagcgg tcgggagtga tattggaggt cgtgtgaaac
    5851  gcttgcgacc ccgtttttct ctctcccgtc actttgacga gcagactagt
    5901  gaatactact ctgctagtga ttgttccgaa ctggatgagt cgttgctcag
    5951  tgaaacacct ggtcttcgtg gaaatgggag gtgtagagat ttgtttcgta
    6001  tcgtatctag acgcgcggta gcgtgtagtg aatacttgat aaatcttttg
    6051  aaacaattaa cgtcgcgtgc cagcgaatac tcctactcgt atgtgatgga
    6101  tttgcttgtg aggttgtatg ttgcaacaga cgatgtcgtt aggcgatgca
    6151  ggtcttttac attcgactgt actgataaag cgtccaactt tttcgtcggg
    6201  tgtctcagtt ggtacaactt gcgttctggt gcctactctg caactcctgg
    6251  gttgggtggt ggtagtagaa gtttaacgac ggtttttccc accggtggtt
    6301  ttgtgcgcgt cattggggta ctttggaacg tcttatcagt agtgtttgat
    6351  gaggaattct ttagaacttt acttcatcgg ttgaggacag acgttgttgt
    6401  ttttctggtg gagttcttga aaaaccttcc cgtaagtttg ttttcagtat
    6451  acactttcat tgagtgtcgg ggtaggattt ttcctttgag agagttccta
    6501  aggggctttt gtcgtttcgt ttgggaaatc gtcgaagggt tgtccatcaa
    6551  tgtctatcag cttctctctg ctgtcgttgt gaaagcgtat cgaagtgcgt
    6601  tcagtcatcg gtttagcgaa gaggatgaga ggacacttcg agtgatcaca
    6651  gaggcggaag gaagaattga gtttttgcga gttgttctcg cggaaatgga
    6701  aaggttccat gctgcgtcaa acgagatgtc tttgtcgagg tcatctgata
    6751  gtccttcgtt cccacctact tacggagaaa ttgtggaatt gaatgacgat
    6801  tcctccgaca gtgcgctagt gataggtgtg gacgatggca ccggccgcgc
    6851  gatcgtcgac cgtgagaccg attctgcgtc tggtagcgac agtgacgttt
    6901  ctattccgtt ggatcgcgat tttgagcaaa tcgggggcct tggtggaaac
    6951  ggtaacgtcg atgtctttcg gctgggtttg agatttactc tgaagttgtt
    7001  gcgcaacctt tttaacgcta gaagttttaa agtgttgtac gggttgttac
    7051  ttcagaccct tttttatggt aattcggtaa ataaatttgt gtctcgtttg
    7101  gtttttagtc ttgggacttg catacctttc gagttattcc ggtttgcgtg
    7151  ttcggcgagg cggttgttca agagtttggc atcatttgtt caccaaacta
    7201  gccttttcag cgaagctacg gtggagcctt tgtttagctt ctcccggtta
    7251  ctttatgact cccggtactt ctcgagtgtg ttttcggaaa tagagagatt
    7301  tgatttctat ttagatcatt tcctttcact cccgaagaga tatcttttcc
    7351  ctaattttag gtttcgaggt tgtgctaggg ctccggttct tgtgactagg
    7401  accgaagaag tgacaccagt ctgtaagaga tccttaaacg acatattgga
    7451  ctctttggat tctctgaagg tgtctgacct caaagggaag tcgacgttcg
    7501  ttgatgatgg ggagtcggat tccggtagtg aactttcggg tagttcgatc
    7551  tcgttcggtt ccgtcaacaa ggaagtctta aacgcggtaa acggtgatgg
    7601  cgtttgcgaa agagctccgt tgatgaaaca cgctaccgcg cttagcaagt
    7651  tggaacccga ccctagtggt cgtaaagata ttcctgtttc caagaaaacc
    7701  tttacgcgcg gtgagtgttc aggcgtgaag tcgaaggtgg gcatgtgtga
    7751  ttacctgatg accttgaatt cttcgtttgg tacagtacct gacatgtacc
    7801  ctgtcgcgcg tgacataacg tataagaaac taactaacgc catgcgcgag
    7851  ttttattact cgcaaaaaat aaccttgtac gaacttcacg gaaagttgag
    7901  ttcttattgg gacgagttga aggtcgcagg tttcgataga aagttaacga
    7951  gaatggactt ggacgatgat gtctatgttg ttgacttcaa tcggaagctg
    8001  ttggtgggga gaaatgggtc tcatccgttt cgtagtacat taaagtccta
    8051  ttgttttatg ttctgcaatg atgggttggt tccttgcccg ggttctcaga
    8101  agtatgatta tgctttgatt tctaatcaaa cgtcttttgt tgccgcgaac
    8151  tcgttcttac gtgctgtgga tggtaaagat ttgactttta ccaatgaaga
    8201  acacagcctt attgtttatg aggctcctcc tggtggtggt aagactcatt
    8251  ctttggtgaa ttgttacgcg gattattgcg ataaagtatc ctgtttagta
    8301  gtgacggcta ataagaattc tcaaactgag atatctcagc gtatatctag
    8351  tgaattgatg agtaggaagc gagctgctaa gtacgttact ggtgcggctt
    8401  ctagagtgtt cactgtggat tcttacttga tgaatcattt gcgacttacg
    8451  actcagttgc tgtttgtcga tgagtgcttt atggttcacg ctggagcaat
    8501  cggcgccgtg gttgaattca cgtcttgtaa agcagtagtt ttctttggtg
    8551  acagcaagca aatccactat attcaccgaa acgatttcgg ggtttctttg
    8601  ttgcatgata ttgatgcatt tattcaaccg gagcatcgtg tttacggcga
    8651  agtatcctat aggtgtcctt gggacatttg tgagtggctt tctgagtttt
    8701  acccgcgaca cgtagctact gctaatgtcg ggagtgtcgg gaaatcgagc
    8751  gtgtcgatag aggaaatcaa tgggtgtgat gacgtacctt acgacaaggc
    8801  agcgaagtac attgtgtaca ctcaggccga aaagaacgat ttgcaaaaac
    8851  atctcggtcg tttaaccgtg ggtcggacca aagtagtacc aattgtaaat
    8901  accgttcatg aggttcaagg agagacttat aaaagggtac gcctggtgag
    8951  gtttaaatat caggaggata ccccgttttc ttcgaagaat catattgtgg
    9001  ttgctttgac tagacatgtt gattctttgg tttactccgt gcttactagt
    9051  aggaggtacg acgatactgc gactaacata gatagggcaa aggaaatttt
    9101  cgataagttt cgttcgacga atcactcgta cggttcatca tcgttagagt
    9151  ggtaccttga aaaatttcct accgaatata aaggtagtaa agcatcctct
    9201  gctccgataa gttgcattaa cgaattcctt aatgaggtgg ttgttggttc
    9251  ttctatcgtg cagttgggtg atgtgtctga agaactgagt tcacgtccct
    9301  ttgaatcagg gtgtgataat gttaccgtaa gagacactgc ccctcccgac
    9351  tccggtaacc tacacgaacc ggctcgtgtt cggcgtagta aggtcgcaag
    9401  caattcctcc aagaaaagcg tcgctacaag aaaaccttct gtcgtacgaa
    9451  agtcgtaatt acaactttat caagacagaa cggtttgttg gaccaagcga
    9501  atttggtagg gcgatggctg ctgccgttat cgaacgttgt ttcaaaatgg
    9551  aagagatggc taagataagg tgtgatatta tatcccttac cgaggctaac
    9601  attttgaaat ggctcgataa gcgcactcct tgtcaaataa aggcagtgca
    9651  ggctgagttg aagcttccct tttcggtgga ggagcagatt accaactaca
    9701  aactgatggt taaacgtgat gctaaggtaa aacttgatga ctcgagtcta
    9751  tctaaacatc ccgctgccca gaacatcatg tttcacaaga agtttattaa
    9801  tgccatattt tccccatgtt tcgatgagtt caaaaataga gtgttgtcct
    9851  cacttaatga caatatcgta ttctttactg aaatgacgaa cgctgggtta
    9901  gcggaagtta tcagaagaat cgttggtgac gacgacaact tatttgttgg
    9951  ggaagtggac ttcagtaagt tcgataaatc tcaggatttg ttcattaagg
   10001  agtacgaacg tacattatat tccgagtttg ggtttgatac tgaacttctc
   10051  gatgtgtgga tggaaggtga gtatcgcgct agggcgacta ctttggatgg
   10101  tcaactgagc ttttcagttg atggtcagcg tcgttctgga ggttcgaata
   10151  cttggattga gaattctctg gtcactctag gcattctctc gttatattac
   10201  gacgtttcaa agtttgaatt gctccttatt tccggtgacg attctttgat
   10251  ttattcaagt gagaagataa gtaacttttc ttctgaaatt tgcttagaaa
   10301  caggctttga gactaagttt atgtctccga gtgtgccata tttttgttca
   10351  aagtttgtgg ttcagaccgg taacaaaacc tgttttgtac ctgaccctta
   10401  taaattatta gtaaagttgg gggctccaca aaacaagtta accgacgatg
   10451  agttatttga gttgtttact tcttttaagg acataacaca ggactttggt
   10501  gatcaagtgg ttttggagaa attgaagttg ctagtcgaag ctaagtatgg
   10551  gtttactagc ggaactacta tgcccgctct gtgtgctata cattgcgtac
   10601  ggtccaatta cttatccttc gagagattat ttccttttat taggggttgg
   10651  tatgttgtcg acgctttgaa gcttagacaa ctaaggaggt tcgccaattt
   10701  aatttgtgaa cgcatagttt acgataatcg cgtgggttac ttttcgtact
   10751  ttgacaatcc gtttactaaa cccgacgcta gcgatggtca aatggacgac
   10801  ttggtgacta gttgatcgtt tgttcagttc tcgctgagag ccaacgttgg
   10851  tagttgagtc gagatgtttg ctttcgcgag cgaaaaccaa gacttattag
   10901  aagaaaaaat atttcgtcgt agaacgtacc atcgtaagta tttcgatgac
   10951  gtggttaggg atttcactat tgatgttggt tatgacgttg atgatcgtga
   11001  ccctacagtg ttggctgact atttttcgtt gtatttcttt ttgcttaaca
   11051  acgataacgt tgggcctctt tcggcttcaa ttgtagtgag cccgccggtt
   11101  agcgggactt ataaaattcg agcgcatgtc gataatcaac caaattgcga
   11151  aggaaacgtg acttacgtta agactaccaa taagagtcgt tttgcaattc
   11201  tcgtaaaagc tgtcccggct ccaatgagag gttattactc ttttcgggcg
   11251  tttcttaccg ataatgtcac tagcgaacgc agtgaattca tatgcagttt
   11301  tatcagtagt agattccttt gttgttgtac gcaaacgata tccgaaaatt
   11351  tgagtaaggt ttgttcgtcc tctttctctt ttagagcagc ctcagaaacc
   11401  gcgattaacg agttttctgt tgcgactgat gatgtagaag acatcaagta
   11451  tgtgagaaaa caagccgagg gtttctcacg ttgcgctgac ccataccctc
   11501  ctaggtgtta tcgcggcgtt agtttaggcg attcttcagg ggttcaaagt
   11551  cgtacaatcg aagaagaagg ttataggacg gataccgcag gtaacgtcgc
   11601  ggtcactatc ccgaacaccc cacttgttag tgctgtctct ccgtatgtcg
   11651  cagagtacaa cgaaaatacg cgttcgcgta tctcgttaat acgccgagtc
   11701  tgttgttacg ccgtttgtgt tttagtggtg tctcttctta taatgagcgg
   11751  tttgttagcc attatattca tataatttga tgtggtaact tacgaggtac
   11801  aattagctaa aactcaccgt ttgactcagt ttaaacgggt ttcaatggac
   11851  tgtgtgattc aaggatttct gacttttctg gttggtatag ctgtgttttc
   11901  ggcctttgcc ggactgatta tcattgttat aacgatttat cggtgtacga
   11951  ctaagcctgt tagaaacgcc tctccttacg gcactcacgc cactgtctaa
   12001  gcagtatggt actcctgggt ttagactttg gtaccacgtt ttcaacgatg
   12051  gctatggctg cgtcttctga gttagttata ctcaaacaat ctaattcatc
   12101  gtatatacct acgtgtttgt ttctgcatgc agatcctaac agtgtgtctt
   12151  atggttacga tgcggagtat ttagcggctt caggggaacc cggctcgttt
   12201  tacaaagatt tgaaacggtg ggtcggttgt actgagaaga attaccaaag
   12251  ctacttgcac aagttatcac catcttataa ggtgatagtg aaagagtttg
   12301  gagctaagag tatgccggtt ccatatttat cacctttgaa taatgatctt
   12351  gggctcagcg tcgctttacc ttcattgatc gctttataca ccaagtccat
   12401  tttatcggat gcggaaagag tgtttaacgt gagttgtact ggtgtcatat
   12451  gttcggtacc tgctggttat aatacgttac agcgagcttt tacgcaacaa
   12501  agtgtatcct tgtcgggtta ctcttgcgtg tatattatta atgaaccttc
   12551  tgctgccgct tactccactc tacctaagtt gagttcggca gataagtatt
   12601  tggccgttta cgatttcggc ggtggaacct ttgatgtttc tatagttagc
   12651  gttagattac ccacgttcgc tgttagaagt tcaggtggtg atatgaactt
   12701  aggcggtaga gacattgata gaaaattatc tgataaaata tatgagttgg
   12751  ctgattttct accgcagaaa gagttgaatg tatctagtct aaaggaggcc
   12801  ttatctcttc aaacggatcc agtcaaatat accgtaacca gttatgggat
   12851  tagtgaaaca gtatcaatcg accaaacgac tttgagggag atagcttcgg
   12901  tgtttataac tcgaacgata gacatactta cacaagttaa ggttaagtct
   12951  agtatgcccg agtcgcaaag tttgaagcta gtagtagtcg gtggaagctc
   13001  gtacctacca gggttgttgg atactttgga aactgtacct tttgtgtctg
   13051  ggataatacc agtggaagac gcaaggaccg ccgttgctag agggtgcgcg
   13101  ttatatagcg agtgcttgga tggtaggtcc aaagccttat taatagattg
   13151  tatcacgcat catttatcgg tcacgacatt tagtgcagac tcggttgttg
   13201  ttgctgcggc cgggagtcca attcctttcg aaggagaaca aaaactcacg
   13251  ttacgtaagt gcgttagtac gtctaattat caagcgagga tgttcgaagg
   13301  agattacgaa aaggttttcc gaaacgagcg tatatacgca gcttcggtat
   13351  cattgtttac tttaggagtt aactggcgtc tgcccaatga cgttgagatg
   13401  actctcgtga ccagagtgga ctcaatgggt aaagtggaat tctaccttaa
   13451  aggtccatct ggtgagttag ttaacgtgca aggtacttca cattatgatt
   13501  atgttggtat gcctcatcct accaggaagt tgttgaggct tagcgattac
   13551  aatgtaaact ccgcagcttt agttttagct ttgacgttga ctcgcgaaaa
   13601  acgagaaaag tttcttttgc gaacgttatt tgatgcttta ctagcagact
   13651  tacgaaagac cgcaagctta agcgaatatt ctaagaaata cccgatcact
   13701  cgaaacgacg tcgatgtcgt ctcatcacgt atggggatcg ttgtttcgaa
   13751  agttttacgg ggaagtgatt tggaaagaat acctctctga atcaactcga
   13801  aatttcgatg agagaaacgt gtcgttggac cacactctga gttcgggtgt
   13851  ggtcgtccgt atgcagagtc ttttgaacgc acctcaaggg actttcgaga
   13901  acgagttagc actattgtac aattcggtgg tgattaatga cttcgttgag
   13951  tttactggta tgccgttgaa gtccttgatg acgagtatcg aggaccgtaa
   14001  ggtacctgac gagttaatat ccgttgaccc gcatgaagtt ggatgtaagt
   14051  ttacgttaaa tgacgtggaa tcatatctaa tgagtagggg tgaagattcc
   14101  gctgatgcga cggcggtcga gcactcgtgg tgtttgagta attcttgcgg
   14151  cagattatta agttcgactg agatagatgc ttacaaaacc atggtgttta
   14201  ctaagagttt cgatagtagt gtatctgggg tgattactaa gttagagact
   14251  tatttatcgt actgcatatc gttgtacaag aaacattgca tgaaagacga
   14301  tgattatttc aatcttatct tacctatgtt taattgttta atgaaagtgc
   14351  tggcatcgct tggtttgttt tatgagaaac atactgacaa tccgctactg
   14401  accggcatgc tcatagagtt ttgcctagaa aataaggtgt actactctac
   14451  ttttaaagtg aatttagaca acgttagatt gtttaagtct aaagtgttgc
   14501  ctgtggtgtt aacggtttgg gatatttctg agcctgacga cccggtggat
   14551  gaaagggtgc taattccttt cgatcctacg gatttcgtgc tcgatttacc
   14601  taaattgagt atacacgaca caatggtggt ggtgggtaat caaatcagac
   14651  agttagagta cgtagtcgag agcgatgctt tagacgattt atctcaacac
   14701  gttgacatac gtttagcagc agacaacccc gatctacgca ttgatctgcg
   14751  ttgggcaggg atgtttgtct actacggcgt ttatcggtgt gctattgata
   14801  gagtggtaga acgaccgacg ttatttagat tgccgctgaa gttactgagt
   14851  caggatgatg gcgaatcgtg cttattacgc atgagtgccg tcgaagcttt
   14901  gtttaatcta gtgcaaaagg tgaacaggga cataaacgtt agacgtcaat
   14951  tcatgggacg tcacagtaaa gtggctttgc gactgtatcg caacttaggt
   15001  ttgaggtttc caccgatctc ttcagttagg ttaccggttc atcacggtta
   15051  tttatacgtc gatttttaca aaagagtacc tgacgatgct gttactgccg
   15101  acgaactcga aagtttgcgt caattacgtt cgtccgtgga cgttatgtgt
   15151  aaggacaggg tgtcaatcac acctccacca ttcaatcgac ttagaagagg
   15201  ttcttctaga acatttagag gtcgaggcgc acgcggtgcg agctcgcgtc
   15251  atatgagcag agacgtggcg acttccggtt ttaatttacc ttatcatggc
   15301  gggtcatacg aggcttccta ataccgatga taaagaaatg gatccggtga
   15351  gtgctgctgt gcccggtaag tatccggatg tcattgagaa atttgtgacc
   15401  aataggtccg tagacgcgtt aatagaaggc gttataagta agctggatac
   15451  caattcaata tacgaagatt ccactgaaaa atttactggt gaatacttaa
   15501  aatatgttat ggttactatg gatactttct tattagaaaa ctacaagacg
   15551  aaaacggaag atctgttggt tcacctagct atgatccaaa agaggttgtg
   15601  cactatatcc acgagcacta aaaccaagtt ccgcgataaa ggttgtatta
   15651  gttacgtgca agggggttcg cgatataagt taatggataa agtagttttt
   15701  cctttcatta tatcgaaatt tactgatagg gagactccga acgctctacg
   15751  taagtatgct tgcactttcg aggagttgca cttgtgtatg gctaggttga
   15801  gacccgactt atacgaaaat aaaaggacga ctaaagccgg aactccacat
   15851  ttaaaaggct acttgtcagc cgactttctt tcgggttctc tcccagggta
   15901  ttccgaacat gaacgaggta tcattcttcg agcgtctgag tctatgttag
   15951  ctagacgtca aggttacgag gaggcaaccg agtttcttaa cctacgtgat
   16001  ttgggtaagt acttgtagtt ggtttgggga cggtaatatt ataccatcct
   16051  ttgagcgctg ctttaagggt cgttaattga cgactcttga tatatttgct
   16101  ggattcgaat tatggacgac gaaacaaaga aattgaagaa caaaaacaag
   16151  gaaacgaaag aaggcgacga cgttgttgcc gctgagtctt ctttcggttc
   16201  catgaactta cacatcgatc caactctgat aacgatgaat gacgtgcgtc
   16251  agttgggtac ccaacagaac gccgctttaa acagagactt atttcttact
   16301  ttgaaaggga agtatcctaa cttacctgac aaagataagg actttcacat
   16351  agctatgatg ttgtatcgtt tagcagttaa aagttcatca ttacaaagcg
   16401  atgacgacac tacgggtata acgtacactc gggagggtgt tgaagtggat
   16451  ttgcctgaca aactttggac tgacgtcgtg tttaactcca agggtattgg
   16501  taaccgtact aacgcccttc gagtttgggg tagaactaac gatgcccttt
   16551  acttagcttt ttgtagacag aatcgcaatt tgagttatgg cggacgtccg
   16601  ttagatgcag ggattccggc cgggtatcat tacctgtgtg cagatttctt
   16651  gaccggagct ggcttgactg atttagaatg tgctgtgtac atacaagcta
   16701  aagaacaatt gttgaagaag cgaggagctg atgaagtcgt agttaccaat
   16751  gtcaggcagc ttgggaaatt tagcacacgt tgatctgttg cgttccgatt
   16801  cccggtttct atcgggatgg tggagtttca tcgtgaacgt gggcgatata
   16851  atagtccggt ttgcgttaca cgttcctaat gaagacatgc tgaataattt
   16901  ttcagctata tcaaattgta cgatcatagc ggacggtagt gctttactaa
   16951  aagataatac cgtggttgat cgtttagaag gcatgaatcc tttggcttat
   17001  ttgttaaatt tagcgaaaac gactactact atttgtttta ctatgtctaa
   17051  taaggttctt tttggtacta ctaaatccga accacttagt tgtttagcta
   17101  tcacgtcaga tcgagttttg ttcaaagtta ttatgggtac taacgttgat
   17151  gattctcgat gcggctgcag tatttggttt tacaacaatg gtacgtttca
   17201  aaacggattg atccgttgtg ataatctcgt cgctttgttt agcgcgactt
   17251  agacacgaag tgaccgttcg gatttaatcg ctgcaatgag ctttcgacgc
   17301  gtgtggttaa aggttatggc tgtagttacg gtattatggt acggtaaaga
   17351  accttccatt agtgaaggtt acaatgctct tatgaatgat gactttaaat
   17401  ttatcgatac gcacttttca aacgtttctt atgctaagaa atgttacgat
   17451  ttggctaatt tcgatttaga ctttctacgc gtcgttatta ttcctttgag
   17501  tggtggtacg gtgaatgaat cgcgtgctaa tcccactaac gtctcagaga
   17551  ttgtcgaatc gcatatgagc gaccgagaca gaatgagcat cttattgcgt
   17601  aataagcgga tccaaattcc ttcgctctta ccttgcggcg gctagagtct
   17651  actcagtagt acgtctacta gtataatgta ttaaacactt tagtaaagag
   17701  ttttgtttaa gttgaacaat atgcgagctt actttagtgt taacgattac
   17751  ataagccttc tggctaaggt tggcgcagtt gtggaacgtt tatgcgatcc
   17801  cagcgtaact ctcacggaag tgatggacga aattaatgac tttaactcat
   17851  tcctcgcttt agtgcactct atgaagtcgg acatgaacgg agaccatcag
   17901  gatggtcacc atgagatggg tgaacacaag tctcggttgt tgtgtaatat
   17951  agaggcgaaa ctgcgagtac ttctcgacat cataagacgt cggttcactc
   18001  gcgaaaaact gctctgtacc agtgccacag atgtcatggg cttcttcgtc
   18051  gtgaggtaca tgagttctag tcacaccagt ttcgagtccg taatgcatac
   18101  ggaattgaag ttagtggtta aggcggtgct gtcagatctg tcccgcacac
   18151  ataaactaga ttttagcgag cgagcctttg cggcttacgg tatcctttta
   18201  caaaagggtg ctgtggcaac cgtttgtagt cagtttgaca ttaatttagt
   18251  ttctccgtct tgcgtgtagg ttaatacgct tctcagaacg tgtggttgta
   18301  ttaactaact ttaattcgaa caaatttatt gtttaaagtc tgtgagttac
   18351  gatggacgat actagcggac aaactttcgt ttctgtgaac ctttctgacg
   18401  aaagtaacac agcgagtact agagttgaaa acgtaaaatc ggaagcggat
   18451  cgcttggagt ttttacgtaa aatgaatccc ttcattattg acgctctggt
   18501  gcggaaaact aattatcagg gcgctcgctt tcgtgcgaga ataataggag
   18551  tgtgcgtgga ttgtggtaga aaacacgaca aggcgctcaa gactgaacgt
   18601  aagtgtaagg tcaacaatac gcaatctcag aacgaggtgg cgcatatgtt
   18651  gatgcacgat cccgttaagt atttaaacaa aagaaaggct agagcctttt
   18701  ctaacgcaga gacgtttgcg attgaattgg ttttgtacac caaggaaaag
   18751  caattggcgg ttgatttggc cgccgaaagg gagaaggcga ggttggctcg
   18801  tagacaccca atgcgttctc cagaggaaac tccggaacat tataaattcg
   18851  gtatgactgc taaagcgatg ttaccggaat tcaacgctgt aggcgttggt
   18901  gataacgaag acacttcgtc ggaataccca gtaagtctga gtgtttccgg
   18951  tggagttctc cgtgaacacc acttcatctg attgaagtgg acggaataag
   19001  ttccttgcgg aactttatat cgggttggta aaaaccctta tgatggtgat
   19051  atatcactag acaataaccg gatgggtaaa gtctttaaaa tgaccgaggg
   19101  gaaagattaa ccgtatcctc tcgttggtct aagctcccac agagtggtag
   19151  tggtctcaag tgaggcttaa cgtatgcgtg aaccaaagaa gttctcctta
   19201  gagtgtgtgt tgtttaccca acacactgtc cctatggggg gccaacatag
   19251  gtcca