Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate Ex348 P25 gene, complete cds.

ACC No: JN082704

Dated: 2011-11-21 | Length: 672 | CRC: 1260774974

                
ID   JN082704; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   JN082704;
XX
DT   21-NOV-2011 (Rel. 110, Created)
DT   21-NOV-2011 (Rel. 110, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate Ex348 P25 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Yokomi R., DeBorde R., Saponari M.;
RT   "Genetic differentiation and biology of Citrus tristeza virus populations
RT   spreading in California";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Yokomi R., DeBorde R., Saponari M.;
RT   ;
RL   Submitted (05-JUN-2011) to the INSDC.
RL   UOS Bari, Institute of Plant Virology, CNR, Via Amendola, 165\a, Bari, Bari
RL   70126, Italy
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="Ex348"
FT                   /mol_type="genomic RNA"
FT                   /country="USA"
FT                   /collection_date="2009"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="P25"
FT                   /note="major coat protein"
FT                   /protein_id="AET62607.1"
FT                   /translation="MDDETKKLKNKNKEAKEGDDVVAAESSFGSLNFHIDPTLIAMNDV
FT                   RQLSTQQNAALNRDLFLTLKGKYPNLSDKDKDFHLAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRSSDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEIVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 192 A; 128 C; 174 G; 178 T; 0 other;

jn082704 Length: 672  21-NOV-2011  Type: N  Check: 1052  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aagcgaaaga
      51  aggcgacgat gttgttgcag cggagtcttc tttcggttcc ttaaacttcc
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttaagtacc
     151  caacagaacg ccgctttgaa cagagatttg ttccttactt tgaaagggaa
     201  gtatcctaat ttgtctgata aagacaaaga ctttcactta gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcaaagtga cgacgacacc
     301  acgggcataa cgtacactcg ggagggcgtc gaagtggatt tgtctgacaa
     351  actttggact gacgtcgtgt ttaattctaa gggtatcggt aaccgtacta
     401  acgcccttcg agtctggggt agaagtagcg atgcccttta tttagcgttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaaatcgta gttaccaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga