Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate 5C p23 gene, complete cds.

ACC No: JN384022

Dated: 2012-11-09 | Length: 633 | CRC: -860632819

                
ID   JN384022; SV 1; linear; genomic RNA; STD; VRL; 633 BP.
XX
AC   JN384022;
XX
DT   01-JUN-2012 (Rel. 113, Created)
DT   09-NOV-2012 (Rel. 114, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate 5C p23 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-633
RX   PUBMED; 22305960.
RA   Licciardello G., Raspagliesi D., Bar-Joseph M., Catara A.;
RT   "Characterization of isolates of Citrus tristeza virus by sequential
RT   analyses of enzyme immunoassays and capillary electrophoresis-single-strand
RT   conformation polymorphisms";
RL   J. Virol. Methods 181(2):139-147(2012).
XX
RN   [2]
RP   1-633
RA   Licciardello G., Raspagliesi D., Bar Joseph M., Catara A.;
RT   "Sequential ELISA/CE-SSCP: a novel method for rapid characterization of
RT   naturally spreading citrus tristeza virus isolates";
RL   Unpublished.
XX
RN   [3]
RP   1-633
RA   Licciardello G., Raspagliesi D., Catara A.;
RT   ;
RL   Submitted (22-JUL-2011) to the INSDC.
RL   Parco Scientifico e Tecnologico della Sicilia s.c.p.a., ZI Blocco Palma I,
RL   Str.le V. Lancia 57, Catania, Catania 95121, Italy
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .633
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus macrophylla"
FT                   /isolate="5C"
FT                   /mol_type="genomic RNA"
FT                   /country="Italy:Sicily"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .630
FT                   /codon_start=1
FT                   /product="p23"
FT                   /protein_id="AEX56592.1"
FT                   /translation="MDDTSGQTFISVNLSDESNTASTEIKAVSSEADRLEFLRKMNPFI
FT                   IDALIRKNSYQGARFRARIIGVCVDCGRKHDKASRTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAEMFAIDLVMHTKERQLAVDLAAEREKTRLARRHPMRSPEETPEH
FT                   YKFGMTAKAMLPDINAVDVGDNEDTSSEYPVSLSVSGGVLREHHFI"
XX
SQ   Sequence 633 BP; 192 A; 125 C; 161 G; 155 T; 0 other;

jn384022 Length: 633  09-NOV-2012  Type: N  Check: 9378  ..

       1  atggacgata ctagcggaca aacttttatt tctgtgaacc tttctgacga
      51  gagcaacaca gctagtactg aaatcaaagc cgtaagttcg gaagcggatc
     101  gcttggaatt tttacggaaa atgaatccct tcattatcga cgctttgata
     151  cggaaaaata gttatcaagg cgctcgcttt cgcgcgagaa taataggagt
     201  gtgcgtggat tgtggtagaa aacacgataa ggcatcgagg actgaacgta
     251  agtgtaaggt caacaatacg cagtctcaga acgaggtggc gcatatgtta
     301  atgcacgatc ccgtaaaata tttaaataaa agaaaagcta gagccttttc
     351  taacgcagag atgtttgcga tcgatttggt tatgcacacc aaagaaaggc
     401  aattagcggt tgatttggcc gctgaaaggg agaagacgag attggctcgt
     451  agacacccga tgcgttctcc ggaagagact ccggaacatt ataaattcgg
     501  tatgactgct aaggcaatgt taccggacat caacgctgta gacgttggtg
     551  ataacgaaga cacctcgtcg gagtacccag taagtctgag tgtttccggc
     601  ggagttctcc gtgaacacca cttcatctga ttg