Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate P60 p23 gene, complete cds.

ACC No: JN384024

Dated: 2012-11-09 | Length: 633 | CRC: 1166899715

                
ID   JN384024; SV 1; linear; genomic RNA; STD; VRL; 633 BP.
XX
AC   JN384024;
XX
DT   01-JUN-2012 (Rel. 113, Created)
DT   09-NOV-2012 (Rel. 114, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate P60 p23 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-633
RX   PUBMED; 22305960.
RA   Licciardello G., Raspagliesi D., Bar-Joseph M., Catara A.;
RT   "Characterization of isolates of Citrus tristeza virus by sequential
RT   analyses of enzyme immunoassays and capillary electrophoresis-single-strand
RT   conformation polymorphisms";
RL   J. Virol. Methods 181(2):139-147(2012).
XX
RN   [2]
RA   Licciardello G., Raspagliesi D., Bar Joseph M., Catara A.;
RT   "Sequential ELISA/CE-SSCP: a novel method for rapid characterization of
RT   naturally spreading citrus tristeza virus isolates";
RL   Unpublished.
XX
RN   [3]
RP   1-633
RA   Licciardello G., Raspagliesi D., Catara A.;
RT   ;
RL   Submitted (22-JUL-2011) to the INSDC.
RL   Parco Scientifico e Tecnologico della Sicilia s.c.p.a., ZI Blocco Palma I,
RL   Str.le V. Lancia 57, Catania, Catania 95121, Italy
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .633
FT                   /organism="Citrus tristeza virus"
FT                   /host="sweet orange"
FT                   /isolate="P60"
FT                   /mol_type="genomic RNA"
FT                   /country="Italy:Sicily"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .630
FT                   /codon_start=1
FT                   /product="p23"
FT                   /protein_id="AEX56594.1"
FT                   /translation="MDDTSGQTFVSVNLSDESNTASTKVENVKSEADRLEFLRKMNPFI
FT                   VDALVRKTNYQGARFRARIIGVCVDCGRKHDKALKTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAEMFAIELVSYTKERQLAVDLAAEREKTRLARRHPIRSPEETPEH
FT                   YKFGMTAKAMLPDINAVDVGDNEETSSEYPVSLSVSGGVLREHHFI"
XX
SQ   Sequence 633 BP; 188 A; 126 C; 165 G; 154 T; 0 other;

jn384024 Length: 633  09-NOV-2012  Type: N  Check: 9834  ..

       1  atggatgata ctagcggaca aactttcgtt tctgtgaacc tttctgacga
      51  aagcaacacg gcaagcacta aagttgaaaa cgtaaaatcg gaagcggatc
     101  gcttggagtt tttacgtaaa atgaatccct ttattgttga cgctctggtg
     151  cggaaaacca attatcaggg tgctcgcttt cgcgcaagaa taataggagt
     201  gtgcgtggat tgtggtagaa aacacgacaa ggcgctcaag actgaacgta
     251  agtgtaaggt caacaatacg caatctcaga acgaggtggc gcatatgttg
     301  atgcacgatc ccgttaagta tttgaacaaa agaaaggcta gagccttttc
     351  taacgcagag atgtttgcga ttgaattggt ttcgtacacc aaggaaaggc
     401  aattggcggt cgatttagcc gctgaaaggg agaagacgag actggctcgt
     451  agacacccaa tacgttctcc ggaagaaact ccggaacatt ataaattcgg
     501  tatgactgct aaggcaatgt taccggacat caacgccgta gacgttggtg
     551  ataacgagga aacttcgtcg gagtacccag tgagtctgag tgtttctggc
     601  ggagttctcc gtgaacacca cttcatctga ttg