Sequence of DPV Tianjin totivirus

Tianjin totivirus, complete genome.

ACC No: JN391187

Dated: 2012-06-05 | Length: 7611 | CRC: -2080908253

                
ID   JN391187; SV 1; linear; genomic RNA; STD; VRL; 7611 BP.
XX
AC   JN391187;
XX
DT   25-MAR-2012 (Rel. 112, Created)
DT   05-JUN-2012 (Rel. 113, Last updated, Version 2)
XX
DE   Tianjin totivirus, complete genome.
XX
KW   .
XX
OS   Tianjin totivirus
OC   Viruses; dsRNA viruses; Totiviridae.
XX
RN   [1]
RP   1-7611
RX   PUBMED; 22421961.
RA   Yang X., Zhang Y., Ge X., Yuan J., Shi Z.;
RT   "A novel totivirus-like virus isolated from bat guano";
RL   Arch. Virol. 157(6):1093-1099(2012).
XX
RN   [2]
RP   1-7611
RA   Yang X., Zhang Y., Shi Z.;
RT   ;
RL   Submitted (25-JUL-2011) to the INSDC.
RL   Wuhan Institute of Virology, Chinese Academy of Sciences, 44# Xiao Hong
RL   Shan, Wuhan, Hubei 430071, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .7611
FT                   /organism="Tianjin totivirus"
FT                   /host="bat"
FT                   /isolate="Tianjin"
FT                   /mol_type="genomic RNA"
FT                   /country="China"
FT                   /isolation_source="feces"
FT                   /collection_date="2007"
FT                   /db_xref="taxon:1163537"
FT   5'UTR           1. .6
FT   CDS             7. .5064
FT                   /codon_start=1
FT                   /product="capsid protein"
FT                   /note="structural protein"
FT                   /db_xref="GOA:H8ZPW9"
FT                   /db_xref="UniProtKB/TrEMBL:H8ZPW9"
FT                   /protein_id="AFE02919.1"
FT                   /translation="MPGYSANYREGPVIVPSGDQVVTSPTSHGRSKGVSSELLTVGGQT
FT                   YKAIASNEVVKSGQAKGEQKFFDENAKIVLLGTFPFKKDLTEEGVEPNPGPVVSDPYAN
FT                   TIYGPLPMHKEAAINLGEQPSAPVKQRPKRHAVVDRVYKTLTLKNGILVTKVVIAGVAT
FT                   YIVYKVGSEVWSWYAAITKPLLGVQTAVKEEYHTLQHKYDYQWYDYFCPMCLLSKYISN
FT                   SGVNGTDAEHHNHVMHALNGNIDCDSSVFGNNFNITTSPQTLTMSGSLTPGKYQTTLTV
FT                   QALIGGTGVVVGTVTFAGKTVAYQVFDDSFASFDLGTVTVSASTTPSVIWTGSTGATLT
FT                   MAVNIICRPITPTTVAISGQPIWTTPYAPAQAVMTVPAVAKALKNTQRAADLSTRNKTR
FT                   HGSNNAISVLNQLATQIDVEDQRLPIYKIEGEREGTHEPSFSCQLTFRGMTKSAFGKRT
FT                   KHEAKTAAASLILEELTRKSNSTWPADAKLTLSGWVRDLTQEGVEPNPGPIANEDGAEC
FT                   WDPEELKMLQAMMAREQQKVLPKMIDDPKLVLDLDEMQQLAPQESCNKTASVEEYQEHV
FT                   RHMSNYSGAVGEAFAVVRWYLLNETTNRFAPLVVMDDSMDEPTVTPVDVSPAKRPSGAA
FT                   RRSDKEEEKPKKPPKKEEIVPAPQPPKTQEQLDEERKFAMQRIADRIKSDPIKLLTWIK
FT                   RPTSTKFKREVLSLAFDIPHINSKPSLDQYETIVYCYFNDIPDDELTIMLLQYDRKWTS
FT                   LSTDCKLSILSACNVRASLEAAKAHNKLMHAYNGNPISADFSEVENAPSFLSLAENTDE
FT                   VLKPYTGLEIQTIITNIVGDANPNQSRIFDQDRLRGNQYSAGGLVTQNAISAIPFTNLI
FT                   PRTIRVGNILVNSANRLQITETNVSEYYSNPIIATKLSEMISDQVKNNQFSTWRRDNTS
FT                   LQGFNAFDIATINTAILPNGLSLESMLLKLSLLHSIKAMNVDAASINRSQYQVIDHNTV
FT                   PTIGAPAVVGVNNSPVFGEDCGGNNPVYPFGGGTGAIAFHVTLQTVPDERKSYAIFVPP
FT                   AILQATSDANEALALFALSMSEWPHALYTVTKQTTDLAGANAGQQVFIPTQSTIHIGGR
FT                   RVLDLIIPRREIAPNPTTLVAANAMCMVRPQAGPDATAGAIPLAAGQLFNMNFIGAPAF
FT                   EEWPLTSYLYSWAGRFDITTIRQYMGRLATMVGVKDAYWAAHELNVALSQVAPKMTTAA
FT                   GGWAAQAANSAQQSDVCYSSLLTVTRSAANFPLANQPAADMRVYDTDPATWNKVALGLA
FT                   TAANLVPEQSMDVPFVVGDARASFWERLQAIPMCIAWTMYYHSRGITTLAWDNAYTDNT
FT                   NKWLQKMVRNTFSTTQSVGTIIPARYGKIVCNLYKNMFHRAPAYVATSVGGKELHITHF
FT                   ERWLPGGTYANVYSGAGAVVNCFSPVLIPDIWCQYFTAKLPLFAGAFPPAQGQNSTKGF
FT                   NSKQGLMIHRNQNNNLVAPYIEKFADNSSYFPVGQGPEINDMATWNGRLWMTTGNVQYL
FT                   DYSGAAIVEAVPPAGELPVGKQIPLLAGENAPIELTNAATTCVPRYSNDGRRIFTYLTT
FT                   AQSVIPVQACNRAANLARSCWLLSNVYAEPALQALGDEVEDAFDTLTNSSFLDVAKSVA
FT                   ESAGEVPATKALTDLQAVDVSSLPSTSDPSNVLSQPAPLMSPPTSSS"
FT   CDS             5319. .7535
FT                   /codon_start=1
FT                   /product="RNA-dependent RNA polymerase"
FT                   /note="nonstructural protein"
FT                   /db_xref="GOA:H8ZPX0"
FT                   /db_xref="UniProtKB/TrEMBL:H8ZPX0"
FT                   /protein_id="AFE02920.1"
FT                   /translation="MNQHLCHLDQTILANLCIWTQLWGLRHLVTLHSLGMLNDIDTYAT
FT                   KMAKVSSFAKRFPFETDNAKQRWCEVNTLTGYMQNDIGTFDYDKEFESLATGGNEHPEW
FT                   WKRKFEEKVRDLMTFQEAPEFVSFETYVKDGYWLTSGSSSIGKVEWSYDGDTGKFKARK
FT                   NMLVDLYTKEEIYQMAIEWDGELMNRVFIKDELAKRRLAVASNIEAYLNQAYLLYLFGH
FT                   GFKNYKYITLDEKPNETHKRNCRLIKLLKEGSYALPFDFKGFDRQPTTDEIKTIIKRVI
FT                   DLVSPRVPASHRRLFNTIAFKNIVCYDKNYLYSPLTKRTVKQTGGLPSGIRPTSLIGNL
FT                   WNMIATDIARDVTKDILGQDYIQEIALKGDDTYIVAPNFFVCLVFRYAYQSINAVGENS
FT                   KFGIMQNACEFLRTEISSSGVRGWTNRAIPSVTQRKPWNPEPWTENQQVQTIANNIYLL
FT                   ERRCKQDCTFLHMANKIKWSKMMHQSYLWLHLPKHHGGFGIYEWSGWLPNCKLPLTQPP
FT                   VFDVANLNPSSVDLSWYSLSDSEKRAYQKVEFSSKIAANDIPGPAKHVMRSYIVALRAC
FT                   KPEWSKTLVNFKPIPLISGPTYTNPFWPHPRIKTDTTSNTNGYPQLSEFVRQHQIAKRA
FT                   KIPVPPLRDMIAKHYPSAYKVMNRCELQGWHRTDSINIACGKIPTEPLKILNPILAAWV
FT                   QQIVLNAGLLKWSGRKNIANRLYAATTLAVHHIQCEGGASMYAF"
FT   3'UTR           7536. .7611
XX
SQ   Sequence 7611 BP; 2062 A; 1968 C; 1766 G; 1815 T; 0 other;

jn391187 Length: 7611  05-JUN-2012  Type: N  Check: 4250  ..

       1  gtaattatgc caggttacag tgcaaattac cgggaagggc ccgtaatcgt
      51  ccctagtggt gatcaggtgg taaccagccc aaccagccac ggccgaagca
     101  agggagtgtc aagcgagctc ctgactgtag gcggtcaaac ctacaaagca
     151  atcgctagca acgaagtcgt taagagcggc caagctaagg gagagcaaaa
     201  attcttcgat gaaaatgcca agatcgtgtt gttgggtacc ttcccgttca
     251  agaaggacct tactgaggaa ggagtagagc ctaacccagg tcccgtcgtt
     301  tccgacccgt acgcgaatac tatctacggg cccctaccca tgcacaagga
     351  agcagccatc aaccttggtg aacaaccatc tgcgcctgtc aaacaaaggc
     401  ccaagcgtca cgctgtcgtg gaccgggtgt acaaaactct cactctgaag
     451  aatggcattc tggtcaccaa ggtcgttatc gctggagtgg ccacgtatat
     501  tgtgtataag gttgggtcgg aagtctggtc gtggtacgcg gctataacca
     551  agcccttgct gggtgttcag actgctgtca aggaagaata ccataccttg
     601  caacacaagt acgactatca atggtacgat tacttctgcc caatgtgtct
     651  gctatccaag tacatctcga actcaggagt gaacggtacc gacgcggagc
     701  atcacaatca cgtcatgcat gcgctgaatg gtaacatcga ctgcgactcg
     751  tcagtatttg gaaacaactt caacatcacg acgtcaccac aaactctgac
     801  aatgagcggt tccttgactc cgggcaaata tcagaccacg ttgacagtac
     851  aggctttgat tggcggaaca ggtgtcgttg tgggcacagt cactttcgct
     901  ggcaaaacgg tcgcatacca agtgtttgac gattcttttg cttcgtttga
     951  ccttggaaca gtgactgtct ctgcttctac taccccgtcg gtaatatgga
    1001  ccggatcaac aggggctact ttgactatgg ctgtcaacat catttgcagg
    1051  ccaataactc caacgaccgt agccatctct ggacagccaa tttggacgac
    1101  tccttacgca ccagctcagg ctgtcatgac cgttccggcg gtagccaaag
    1151  cgctcaaaaa cacgcaaaga gccgctgact tatcgactag gaacaagacg
    1201  agacacggtt cgaacaacgc catttcagtc ttgaatcagt tggccaccca
    1251  gatcgacgtc gaagatcagc gcttgccaat ttataagatc gaaggagaga
    1301  gggaaggtac tcatgagcct agcttctctt gtcagctgac attccgcggc
    1351  atgactaaga gtgcgtttgg caagcgaaca aaacatgagg ctaagacagc
    1401  agccgcatcc ttgatcttgg aggaactgac caggaaatca aactccacgt
    1451  ggccggcgga cgcaaagctt acgttgtctg gatgggttag ggacctgact
    1501  caagaaggag tcgaaccgaa tcctggcccg atcgccaacg aggatggagc
    1551  cgaatgctgg gacccagaag agctgaagat gctgcaggct atgatggcta
    1601  gagaacagca aaaagtattg cctaagatga tcgacgaccc gaagctcgtt
    1651  ttagacttgg acgaaatgca acaactagct cctcaagaga gctgcaacaa
    1701  gaccgccagt gttgaggagt atcaggaaca cgtcagacat atgagtaact
    1751  attccggcgc cgttggcgag gcattcgctg tcgtgcgttg gtacttgctg
    1801  aatgagacga ctaaccggtt cgctccgctc gtggttatgg atgattctat
    1851  ggatgagccg actgtcacgc cagtagatgt cagtccagca aagcgcccga
    1901  gtggcgctgc tcggaggtcg gacaaggaag aggaaaaacc gaaaaagcca
    1951  cccaagaagg aagagatcgt tcccgccccc cagccgccta aaacgcaaga
    2001  acagcttgat gaagagcgca aatttgctat gcaacgtata gctgatcgca
    2051  tcaagtccga cccaatcaag cttttgacct ggatcaagag acccacgtcc
    2101  acgaagttca aacgtgaggt gttgtctctt gctttcgata tccctcacat
    2151  caactcgaaa ccaagccttg atcaatacga aaccattgtt tactgttatt
    2201  ttaacgacat accagatgac gaactcacga ttatgctctt gcaatatgac
    2251  aggaaatgga catctctatc taccgattgc aaactttcta ttctctcagc
    2301  ttgtaatgtt cgagcttcgc tggaagcagc gaaagcgcat aataagctga
    2351  tgcatgcgta caatggcaac cccatttccg cagatttttc tgaagtagag
    2401  aacgctccct ctttcctttc cctcgccgag aacaccgacg aggtgctcaa
    2451  gccttacacg gggcttgaga ttcaaacgat cattacaaac attgtcggtg
    2501  atgctaatcc gaatcagtcc agaatttttg accaggatag actgcgcggt
    2551  aaccagtatt ctgctggtgg cctggtcact caaaatgcta tatctgcaat
    2601  tccattcacc aacctaatac ctaggacaat ccgagtaggc aacattctgg
    2651  tcaactcggc taatagactc cagatcaccg aaaccaacgt cagcgaatac
    2701  tactctaatc ctattatcgc gactaaactt tctgaaatga tcagcgatca
    2751  agtcaaaaac aatcaattct cgacatggcg tcgtgacaac acgtcactgc
    2801  aaggtttcaa cgcattcgac attgctacca tcaacacggc catcttgccg
    2851  aacgggttat cgctagaaag catgttgctc aagctgtcct tgctccactc
    2901  gatcaaggct atgaacgtcg acgccgccag tatcaaccga tcacaatatc
    2951  aagtcatcga ccataacaca gtacccacaa ttggtgcgcc tgctgtagtg
    3001  ggcgtgaaca actctcccgt gtttggcgaa gattgcggcg gcaacaaccc
    3051  tgtttatcct tttggtggag gaaccggcgc tatcgcgttc cacgtcacct
    3101  tgcaaactgt gcccgacgag cgcaagtcat acgctatctt tgttccgccg
    3151  gctatattgc aggccacttc cgatgctaac gaggcattgg ccttgttcgc
    3201  cttgtcgatg agcgaatggc cacacgcact ctacacagtt accaaacaaa
    3251  cgaccgatct tgctggcgcc aatgctggcc agcaggtgtt catcccgaca
    3301  cagagcacta ttcacattgg tggtcggcga gttctcgatt tgatcattcc
    3351  gcgtcgagag atagcgccaa atccaactac cttggttgcc gcgaacgcta
    3401  tgtgcatggt caggcctcaa gccggaccag atgccacagc tggagctatt
    3451  cccttggcag caggacagct attcaacatg aacttcatcg gtgccccggc
    3501  atttgaagag tggcctttga catcttattt gtactcctgg gctggtcggt
    3551  tcgatattac cacgatccgt cagtacatgg gcaggctagc gacgatggtt
    3601  ggagtgaagg acgcatactg ggctgctcat gaactaaatg ttgctttaag
    3651  tcaggtggcc cccaaaatga ctacagcagc cggaggctgg gctgctcaag
    3701  cagctaattc tgcacaacag agtgatgtgt gttattccag tttgttgacc
    3751  gtgacacgat ctgctgctaa cttcccactt gccaaccaac cagctgccga
    3801  catgcgtgtg tatgacactg acccagctac gtggaacaag gtagccctcg
    3851  gtctggctac ggcagccaat ctggtacccg aacagtccat ggacgtgcct
    3901  tttgttgtcg gtgatgctag agcatccttt tgggaacgtc ttcaagccat
    3951  accaatgtgc attgcctgga caatgtacta tcattcgcgc ggtatcacca
    4001  ctctggcttg ggacaacgcc tacactgaca acacaaataa atggctgcag
    4051  aaaatggtgc gcaacacgtt ctccacgacc cagtcagtcg gaactataat
    4101  tcctgcacgc tacgggaaga ttgtctgcaa cttgtacaag aatatgttcc
    4151  accgtgcccc agcgtatgtg gctacaagcg ttggtggcaa ggagttgcac
    4201  atcacgcact tcgaaaggtg gttgcccgga ggcacatacg cgaacgttta
    4251  ttccggtgcg ggcgctgttg tcaattgttt ttctcctgtt ttgataccgg
    4301  acatttggtg tcagtacttc acagctaaat tgcctctctt cgctggcgct
    4351  ttcccacccg ctcaaggtca gaactccacg aagggtttca attctaagca
    4401  ggggttgatg atccatcgca accaaaataa caacctcgtg gcaccataca
    4451  ttgagaagtt tgctgacaac agcagctact tccccgttgg ccaagggcct
    4501  gaaatcaatg acatggcaac atggaacggt agactttgga tgacgactgg
    4551  aaacgtgcag tatcttgatt actccggtgc tgctatcgtc gaagcggtgc
    4601  cacctgctgg tgagttacca gtcggcaagc agatcccgct gctggccggc
    4651  gaaaacgctc ccattgaact gaccaatgct gctaccacat gtgtaccacg
    4701  ctattcgaat gacgggcggc gcatcttcac ttatctgacc acggcccaat
    4751  ctgttatccc ggttcaagca tgcaatcgag ctgctaacct tgcccgttca
    4801  tgttggttgc tttccaatgt atatgcggag ccagcgcttc aagccctggg
    4851  agacgaagtt gaggacgcgt ttgacacgtt aacaaattcg tcttttttag
    4901  atgtggccaa gtcggttgcg gagagtgctg gggaagttcc ggcgacgaag
    4951  gcactgaccg acttgcaggc tgtggacgtg tcaagcttgc cgagtacttc
    5001  agatccatca aacgttttgt cccaaccagc tcctttgatg agtccaccta
    5051  cttccagctc ttgaagtact tacacaatca aacttcatca tcttcacata
    5101  acaacatttc ccgccttact gacggcctag ttagatatgg ccatctcacc
    5151  gatcataaaa ttttcatctt catttcagaa aatcttgaac cgcaacaacc
    5201  tatatctacg cctggagaca ttctgacaac tgagtaccga gtgaaatcag
    5251  atcttgcagt gacgagattg cgcatcaagg actttatagc acgcattgac
    5301  ccagacatca tcaaattcat gaaccaacac ctatgtcatt tggatcaaac
    5351  gatattggca aatttgtgca tctggactca attgtggggc cttcgccatt
    5401  tggtcacgtt acactctctc ggcatgctca atgacataga cacctacgct
    5451  actaagatgg ccaaagtgag ctctttcgct aaacgtttcc ctttcgagac
    5501  agacaacgcc aagcaacgtt ggtgtgaggt taacactctc actggctaca
    5551  tgcagaatga cattggcact ttcgactatg acaaggagtt cgaatcgctc
    5601  gccacgggtg gaaacgaaca ccccgagtgg tggaaacgca aatttgaaga
    5651  aaaagttcgg gacttaatga cttttcagga ggcgccagag ttcgtaagct
    5701  ttgaaacgta tgttaaggat gggtattggc tgacttcggg tagttcaagc
    5751  attggcaaag tcgaatggtc ttacgacggt gacaccggca agttcaaagc
    5801  tcgcaaaaac atgcttgttg atttgtacac taaggaagaa atctatcaga
    5851  tggctattga atgggatggc gagctgatga acagagtttt tatcaaggac
    5901  gaacttgcta agcgacgcct agctgttgcc agcaacattg aggcgtatct
    5951  taatcaggct tacctactgt atctctttgg acacggtttc aaaaattaca
    6001  agtacatcac gttagacgag aaaccaaacg agacgcacaa gcggaattgc
    6051  agactgatca aattattgaa agaagggagt tatgctttac cattcgattt
    6101  caaaggattt gaccgacaac cgaccactga cgagatcaag accataataa
    6151  agcgggtcat cgaccttgtt tctcctcgtg ttcctgcttc tcatcggcgc
    6201  ttatttaaca ctattgcttt caagaacatt gtctgttacg acaagaacta
    6251  tctctattcc ccattgacta aacgaacagt gaaacaaacg ggtgggctac
    6301  cgtctggaat tagaccaact agtttaatcg gcaacttgtg gaacatgata
    6351  gcgactgaca ttgctcgcga cgtcaccaaa gacattctgg gacaggatta
    6401  catccaagag attgcgctca aaggtgatga tacgtacatc gtcgcaccta
    6451  acttctttgt ttgtctggtt ttcaggtatg catatcaatc catcaatgca
    6501  gttggagaaa attcaaaatt tggtataatg caaaacgctt gcgaattcct
    6551  gcgaaccgaa atctcatcct caggcgttcg cggctggacc aatcgcgcta
    6601  ttccttctgt aacacaacga aaaccatgga accctgagcc ttggacagag
    6651  aatcaacaag tccagaccat cgccaataac atctatcttc ttgagcgtcg
    6701  ttgcaaacaa gattgtacat tccttcacat ggctaacaaa atcaaatgga
    6751  gcaagatgat gcaccaatcc tatctctggt tgcatctacc taaacaccac
    6801  ggtggattcg ggatctacga atggtccggt tggctgccta attgtaagct
    6851  accacttaca cagccgccgg tatttgacgt agccaacctc aatccatcgt
    6901  cggtcgacct atcttggtat tcgctctctg atagcgaaaa acgtgcttac
    6951  cagaaggtcg aattttcatc taaaatagcg gccaacgaca tccccggacc
    7001  cgctaagcac gtcatgcgtt cttacattgt ggctcttaga gcttgcaaac
    7051  ctgagtggag taaaacgctt gtcaacttta aacccatacc actcatctca
    7101  gggccaactt acaccaatcc attctggccc catcctcgca tcaaaactga
    7151  cacaaccagt aacaccaacg gttatcccca gttgtctgag tttgttcgtc
    7201  aacatcaaat tgccaaacga gcaaagatac ctgttccacc actgcgcgac
    7251  atgatagcaa aacactatcc gtcagcatac aaagtcatga acaggtgtga
    7301  attgcaaggc tggcatcgaa cagactcaat caacatagcg tgtggcaaaa
    7351  taccaaccga gccactcaaa atcttgaatc caatattagc agcttgggtt
    7401  caacagatag ttttgaatgc tggtctcctc aaatggagcg gtcggaaaaa
    7451  catcgccaac cgactgtatg ctgctacaac actggcagta caccacatcc
    7501  agtgtgaagg gggggcgtca atgtacgctt tttaaagtgg tctggcaacc
    7551  caccatgctt agtcttatca acttcttata agccagctgg ctaccccact
    7601  aagacatggt c