Sequence of DPV Phytophthora infestans RNA virus 4

Phytophthora infestans RNA virus 4 isolate FLa2005, complete genome.

ACC No: JN400241

Dated: 2012-02-24 | Length: 2984 | CRC: -983329375

                
ID   JN400241; SV 1; linear; genomic RNA; STD; VRL; 2984 BP.
XX
AC   JN400241;
XX
DT   30-AUG-2011 (Rel. 109, Created)
DT   24-FEB-2012 (Rel. 111, Last updated, Version 3)
XX
DE   Phytophthora infestans RNA virus 4 isolate FLa2005, complete genome.
XX
KW   .
XX
OS   Phytophthora infestans RNA virus 4
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Narnaviridae;
OC   unclassified Narnaviridae.
XX
RN   [1]
RP   1-2984
RX   PUBMED; 21971871.
RA   Cai G., Myers K., Fry W.E., Hillman B.I.;
RT   "A member of the virus family Narnaviridae from the plant pathogenic
RT   oomycete Phytophthora infestans";
RL   Arch. Virol. 157(1):165-169(2012).
XX
RN   [2]
RP   1-2984
RA   Cai G., Myers K., Fry W.E., Hillman B.I.;
RT   "A member of the virus family Narnaviridae from the plant pathogenic
RT   oomycete Phytophthora infestans";
RL   Unpublished.
XX
RN   [3]
RP   1-2984
RA   Cai G., Myers K., Fry W.E., Hillman B.I.;
RT   ;
RL   Submitted (27-JUL-2011) to the INSDC.
RL   Plant Biology and Pathology, Rutgers University, 59 Dudley Rd, New
RL   Brunswick, NJ 08901, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .2984
FT                   /organism="Phytophthora infestans RNA virus 4"
FT                   /host="Phytophthora infestans"
FT                   /isolate="FLa2005"
FT                   /mol_type="genomic RNA"
FT                   /country="USA:Florida"
FT                   /isolation_source="infected tomato"
FT                   /collection_date="2005"
FT                   /db_xref="taxon:1077832"
FT   CDS             43. .2931
FT                   /codon_start=1
FT                   /product="RNA-dependent RNA polymerase"
FT                   /db_xref="GOA:G3LIT8"
FT                   /db_xref="UniProtKB/TrEMBL:G3LIT8"
FT                   /protein_id="AEM89291.1"
FT                   /translation="MQEDLILVQPDTDWVGGVNRSWRSLLPVLNGVEYILPRGSLVGLK
FT                   LHGRSTLPQSWERGDRYHSDLLKRDLMIRLTRDLGLSGRHADRLVNRPAIHLKRIEEFI
FT                   SGLVDSFWLGDPRTFALGSPDFKTFRTIVRKIFAVGTSNLGMLMTNWKEWTNWFTHSVC
FT                   ETELREEAKLSNHNMFHRLARLSVVQKALSGDVPLMELGSIVAHLTSTRQMPYMGLPTE
FT                   VKAKADFIEIISTPFHVEPSHHRQMVQCAARMGRLCMSLRNGVPVSDRSSHFSATSSGE
FT                   LDHSLTRGGQAQALKDAIDKWLIPASGSTYMEDTPFGVAEHREGVPLWKTLFVDQETQL
FT                   ELIFSDFGDSLDWIKDVPGRVYGLDDYTGRQILYVAWKEMEDIPHIRASTVPELGNKAR
FT                   IVTLSAFWLNVLQAPLSHIMKEVLKYHPSCFASFTRGDQAWHAASGLGRLNPRSVAGYS
FT                   VLSSDLKNATNAQHIALTRDMLRAFIYSSGLVVSEAYVNLVLDTICPRLVELDGEFTLS
FT                   CRGIMMGEAIAKPSLTLLNLVVEELAFLKYENKLVLLNTDKAAPSRRWRCYHVGGDDHL
FT                   AVGPDQYLDLITHNHELSGSIISPDKHGKSRKMVKYCERVLLVQNLQYNTPDRKPFEHG
FT                   LIVDSIKVRLLEKGQSTLIAKDNKNVAVGKSQQLVKSLDWLPKQLYSKGFIRSIQHLFI
FT                   KRMGSLLPNRNRDEEAFHSVCLPKILGGYGLGLAEDLLTHLSKSKPEIQQTVSAVLYGI
FT                   ETRRARNILSRLNTTISDRSIQGTKWYEDEMVQQFREYPDMVGAIDGREMRRRFPASTY
FT                   QESKAHAASAGWLPIDQLARRVTRGHLFGELMSGGAKRQNVFKTRNWIQEFTRLRKRLE
FT                   EEVGYLPLPEYADLEVKTLRNALGAMTTDLFIDSRQVTSFDKGVGDDSFDFFDGELLRT
FT                   YEAHQPNLVVGLQFIGLDSTCNAFTRRVRRRY"
XX
SQ   Sequence 2984 BP; 799 A; 687 C; 748 G; 750 T; 0 other;

jn400241 Length: 2984  24-FEB-2012  Type: N  Check: 1537  ..

       1  ttcctgcata attttttttc cacgaaagtg gaaagcacgt ttatgcagga
      51  agacctcatc ctagtccagc cggataccga ctgggttggt ggggtcaacc
     101  gatcatggag aagcttgtta ccggtcctca acggggtaga atatattcta
     151  cctcgcggat cgctagtagg cttaaaactc cacggtcgtt ccacacttcc
     201  acaatcgtgg gagcggggcg atcgttatca ttcggatctc cttaagaggg
     251  atctgatgat aaggctaacg agggaccttg gtctctcggg acgccatgcg
     301  gatcgtttgg tcaatagacc ggcgatccac ttgaagcgga ttgaagagtt
     351  catatctgga ctcgtcgata gcttctggtt aggagatcct aggacattcg
     401  ccttgggatc tcccgacttt aaaaccttcc gaacaatagt ccggaaaatc
     451  tttgccgtag gcacttccaa tttgggaatg cttatgacta attggaagga
     501  atggaccaat tggttcactc attccgtatg tgagacagaa ttgcgtgagg
     551  aagcgaagct ttctaatcac aatatgtttc acagactggc gagactttct
     601  gtcgtacaga aggccttgtc aggagatgtg ccactgatgg agcttggctc
     651  catcgtcgca catcttacct caacgcggca aatgccatat atgggattac
     701  cgactgaggt aaaggcgaag gctgatttca ttgaaatcat ttctacgcct
     751  ttccacgttg aaccttctca ccatcgtcag atggttcaat gtgctgcccg
     801  aatgggtagg ctctgtatga gtctacgcaa tggggttccg gtgagcgata
     851  gaagtagtca cttctccgct acatcgtcag gtgaacttga ccactcccta
     901  accagggggg gacaagcaca agcgctgaaa gatgccatcg ataaatggct
     951  gattccagct tccggtagca cttacatgga ggatactcca tttggtgtcg
    1001  ccgaacacag agagggtgtt ccattatgga aaactctttt tgtggaccaa
    1051  gagactcagc tagagctgat tttctcggac ttcggggatt cccttgactg
    1101  gatcaaggat gtcccaggaa gagtatacgg tcttgacgac tacacaggtc
    1151  gccagatcct atacgtagct tggaaggaaa tggaagatat tccacatatc
    1201  cgagcttcta cggtgcctga gttaggaaac aaggcccgta tcgtgacact
    1251  ttcagccttt tggctgaatg tgttacaagc gcctctttca cacataatga
    1301  aggaggtgct caagtaccat cctagttgct tcgcgagttt cactcgcggc
    1351  gaccaggcat ggcacgcagc cagcggactg ggtaggttaa atccccgctc
    1401  cgtcgccggt tacagtgtgc tttcttcaga tttgaagaac gccactaatg
    1451  ctcagcatat tgcgctaacg cgtgatatgc tgcgcgcatt catatattct
    1501  tcgggacttg tagtctcgga ggcctatgtg aatttagtct tggacacaat
    1551  atgccctaga ctagtcgaac tagatgggga atttacactc tcgtgtagag
    1601  gaatcatgat gggggaggct attgccaaac cctcactgac tctccttaat
    1651  ctagtcgtcg aagagctagc ttttctcaaa tatgagaata agctggttct
    1701  tcttaacacc gacaaagctg cgccatcgcg tagatggcgg tgttatcatg
    1751  ttggagggga tgaccatctc gcggtgggtc ccgaccaata tctagaccta
    1801  atcactcata atcatgagtt atcaggttct atcatctccc cggacaaaca
    1851  tggtaagtcc aggaagatgg tgaaatactg tgaacgcgta ctattagtac
    1901  agaatttaca gtataatacc ccagatagaa aacctttcga gcatggcttg
    1951  attgtggatt ctattaaggt aaggcttctc gagaagggtc aatcgactct
    2001  gatcgcgaag gataacaaga atgtcgcggt tggtaaatcg caacaacttg
    2051  ttaaatctct tgactggttg ccaaagcaac tttattccaa gggattcatc
    2101  cgttcgatac aacatttgtt tatcaagcgg atggggagtt tattaccaaa
    2151  tcgcaatcgc gatgaggaag cattccattc cgtgtgtctc cctaagatat
    2201  tgggaggtta cggactcggc ttggctgagg atctattgac ccacctatcc
    2251  aagtcgaaac ccgaaataca gcagacagta tccgctgtac tctacgggat
    2301  cgagaccaga cgagcaagaa atatcctgtc ccgcctgaac acgacaatct
    2351  ccgaccgctc aattcaagga acgaagtggt acgaagacga aatggtacaa
    2401  caattcaggg aataccccga catggtaggt gccattgacg gtagggagat
    2451  gcgcagaaga tttcctgcgt caacctatca agaatcgaaa gcccacgccg
    2501  cgtcagcggg ttggcttccg atagatcagc tagcccgaag agtgacccgt
    2551  ggtcacctat ttggtgagct gatgagtggc ggtgcgaaaa gacaaaatgt
    2601  cttcaagacc cgcaactgga tccaagagtt cacgcgattg cgcaaacgcc
    2651  tggaggaaga ggttgggtat ttaccgttac cggaatacgc cgacctagaa
    2701  gtcaagaccc tcaggaatgc cctgggagcg atgacaacag acttgttcat
    2751  tgactctcgc caagttacaa gttttgacaa aggagtagga gacgatagct
    2801  tcgacttctt tgatggtgaa ctacttagga cttatgaagc ccatcaaccc
    2851  aacctagtgg tcgggctgca gttcatcggt ttagatagta cctgtaatgc
    2901  ttttacccgt agggtgaggc gtagatacta atctaaaaat taaaacgtgc
    2951  attcgactat agtcgaaaaa aaggaaaaaa gaaa