Sequence of DPV Lettuce necrotic stunt virus

Lettuce necrotic stunt virus isolate L2, complete genome.

ACC No: JN700748

Dated: 2012-07-03 | Length: 4772 | CRC: 182686886

                
ID   JN700748; SV 1; linear; genomic RNA; STD; VRL; 4772 BP.
XX
AC   JN700748;
XX
DT   03-JUL-2012 (Rel. 113, Created)
DT   03-JUL-2012 (Rel. 113, Last updated, Version 1)
XX
DE   Lettuce necrotic stunt virus isolate L2, complete genome.
XX
KW   .
XX
OS   Lettuce necrotic stunt virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RC   Publication Status: Available-Online prior to print
RP   1-4772
RX   PUBMED; 22527864.
RA   Wintermantel W.M., Anchieta A.G.;
RT   "The genome sequence of lettuce necrotic stunt virus indicates a close
RT   relationship to Moroccan pepper virus";
RL   Arch. Virol. 0:0-0(2012).
XX
RN   [2]
RP   1-4772
RA   Wintermantel W.M., Anchieta A.G.;
RT   ;
RL   Submitted (20-SEP-2011) to the INSDC.
RL   Virology, USDA-ARS, 1636 East Alisal Street, Salinas, CA 93905, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4772
FT                   /organism="Lettuce necrotic stunt virus"
FT                   /host="lettuce"
FT                   /lab_host="Nicotiana benthamiana"
FT                   /isolate="L2"
FT                   /mol_type="genomic RNA"
FT                   /country="USA:California, Monterey County, Salinas Valley"
FT                   /collection_date="1998"
FT                   /note="virus stored as frozen sample in Nicotiana
FT                   benthamiana tissue and reactivated for sequencing"
FT                   /db_xref="taxon:167947"
FT   CDS             join(167. .1054,1058. .2623)
FT                   /codon_start=1
FT                   /ribosomal_slippage
FT                   /product="92 kDa protein"
FT                   /note="replication protein; P92"
FT                   /protein_id="AFM91097.1"
FT                   /translation="METIKRMIWPKKEIFVGDFATGVNRTAPVDIFQLVCRVVLRYMRT
FT                   GKIECDSDSMTKFVVELLKTDCAAKWEWFMKRRQRGDYIVPLSIASIPIIPLLSYATRV
FT                   RAVSVKAFGNELTFNIRVPRPSVPKKGLLLRLAAGLALAPICALAMYATLPREKLSVFK
FT                   LRTEARAHMEDEREATDCLVVEPARELKGKDGEDLLTGSRMTKVIASTGRPRRRPYAAK
FT                   IAQVARAKVGYLKNTPENRLIYQRVMIEIMDKDCVRYVDRDVILPLAIGCCFVYPDGVE
FT                   ESAALWGSSESLGVKGGLVRLPGVVTQTNRDIPSGVLLPQEVLEVRTGPPNAKDRNIFM
FT                   VAGCPSQARFLVHNHCLKNLKRGLVERVFCVEKNGILTRTPQPTKGAFSRLSPFRKAVC
FT                   EKVGVAHRLGYDGFLSYYNGAKLRTYKRAVESLHITPVSERDSHLTTFVKAEKISTAKG
FT                   DPAPRVIQPRNPRYNVELGRYLRHMESKLMKAVDGVFGETTCIKGYTADEVGAIFREKW
FT                   DRFDKPVAIGLDASRFDQHCSVEALQFEHSFYRALYPGNKLLSKLLDWQLHNKGKGYVP
FT                   DGTITYRKEGCRMSGDINTSLGNYLLMCAMIYGYMRHLGINEFSLANCGDDCVLIVERR
FT                   NLKQIQGTLPEYFLNLGYTMKVEKPVFQLEEVEFCQAHPVQFQGGWKMVRNVRTAMSKD
FT                   VHCVNNIRDLATRRAWSNAQHFGGRALTSGIPVVDKFYSRFVVYDAPKKHQRIDTVTNV
FT                   HKWRGSGGAYTVTPESRASFWAAFGLTGDEQLALEDRLDRWEMDLFGEEGVDAHEPSIL
FT                   DSAVA"
FT   CDS             167. .1057
FT                   /codon_start=1
FT                   /product="33 kDa protein"
FT                   /note="replication protein; P33"
FT                   /protein_id="AFM91098.1"
FT                   /translation="METIKRMIWPKKEIFVGDFATGVNRTAPVDIFQLVCRVVLRYMRT
FT                   GKIECDSDSMTKFVVELLKTDCAAKWEWFMKRRQRGDYIVPLSIASIPIIPLLSYATRV
FT                   RAVSVKAFGNELTFNIRVPRPSVPKKGLLLRLAAGLALAPICALAMYATLPREKLSVFK
FT                   LRTEARAHMEDEREATDCLVVEPARELKGKDGEDLLTGSRMTKVIASTGRPRRRPYAAK
FT                   IAQVARAKVGYLKNTPENRLIYQRVMIEIMDKDCVRYVDRDVILPLAIGCCFVYPDGVE
FT                   ESAALWGSSESLGVK"
FT   CDS             2645. .3820
FT                   /codon_start=1
FT                   /product="capsid protein"
FT                   /protein_id="AFM91099.1"
FT                   /translation="MAMVARNNNTALVPYSGGKRGLQKAFGFGATIVGQKIYDNRGKIV
FT                   GFMVEQGKKGLSKMANALGSGNGQKAQNLVGGMGGAIMAPVAVSRQLRGSKPRFTGRTA
FT                   GSVTVTHREYVRQVNNTSAFTVNGGIVGNLYQLNPLNGTLFTWLPSIASNFDQYAFNNI
FT                   TLHYVPLCSTTEVGRVGLYHDKDSQDPEPTDRQELANFSTLKETPPWGEVMLRIPTDRI
FT                   KRYCDDSNAVDHKLIDLGQVGIATYGGAGANAVGDVFISYSITLFSPQPTSSLLSTRRQ
FT                   SLLGATGLTTGPSYLTVSSTATVLTLTFRATGTFMVSGHFRDTGAAVLGLAGNINVNSL
FT                   TVLDTVGLATSFSINCSVSALPSTITFTSTAITSSTVHCVRAVRANDATLL"
FT   CDS             3854. .4423
FT                   /codon_start=1
FT                   /product="22 kDa protein"
FT                   /note="P22"
FT                   /protein_id="AFM91100.1"
FT                   /translation="MDTEYEQVNKPWNELYKETTLGNKLTVNVGMEDQEVALLPSNFLT
FT                   KVRVGLSGGYITMRRIRIRITPLVSRKAGVSGKLYLRDISDTTGRKLHCTESLDLGREI
FT                   RLTMQHLDFSVSTRSDVPIVFGFEELVSPFLEGRELFSISVRWQFGLSKNCYSLPQSKW
FT                   KVMYQEDALKVLKPSKKKASKTDSSV"
FT   CDS             3886. .4404
FT                   /codon_start=1
FT                   /product="19 kDa protein"
FT                   /note="P19"
FT                   /protein_id="AFM91101.1"
FT                   /translation="MERAIQGNDAREQANSERWNGGSGGSTSPFKFSDESPSWTEWRLH
FT                   NDETNSNQDNPLGFKESWGFGKVVFKRYLRYDGTEASLHRVLGSWTGDSVNYAASRFFG
FT                   INQIGCTYSIRFRGVSVTISGGSRTLQHLCEMAVRAKQELLQLTPVEVESDVSRRCPEG
FT                   FKTFEEESE"
FT   CDS             4487. .4663
FT                   /codon_start=1
FT                   /product="putative 6.5 kDa protein"
FT                   /note="ORF6"
FT                   /protein_id="AFM91102.1"
FT                   /translation="MMTSQVGLYGGFGRPWDGDMERVSYAVRLTSVELAIWAYAWISHN
FT                   ITAQCKLDANLQP"
XX
SQ   Sequence 4772 BP; 1244 A; 1005 C; 1292 G; 1231 T; 0 other;

jn700748 Length: 4772  03-JUL-2012  Type: N  Check: 4767  ..

       1  agaaattccc caggatttct cgacctagtt cgtttatctg gtgacttgcg
      51  cttctgttgc tttgcgtagg gaatttctct ccttaattac tatctttaat
     101  tttggggttt gaaggttggg tctacccttc ggggggataa attgtaactt
     151  ccaacaaata agcacaatgg agaccatcaa gagaatgatt tggcctaaga
     201  aggagatctt tgtaggagat tttgcgaccg gagttaatag gacggcaccg
     251  gtggacatct tccagttggt gtgtcgtgtg gttctgagat acatgaggac
     301  agggaaaata gagtgtgatt ctgacagcat gacaaagttt gtggttgagt
     351  tacttaagac agactgtgct gccaaatggg agtggtttat gaagagacgg
     401  cagaggggtg actacatcgt ccctctatct atagcctcca tcccaatcat
     451  accgctgttg agttacgcca cgagggtacg cgcagtctca gtcaaggctt
     501  tcggtaatga acttacgttc aatattcgag tgcctagacc atctgtacct
     551  aagaaaggtt tactcctcag actggcggca ggactagcac ttgcacctat
     601  atgcgcgcta gccatgtacg ctaccctacc tagggaaaaa ctgtcggtat
     651  tcaagcttag aactgaggca cgggctcaca tggaggatga gagagaagcg
     701  acagattgtt tggtggttga accggctcgt gaacttaagg ggaaggatgg
     751  agaggatctc ctcactggta gtagaatgac aaaggtaatt gcgtccacgg
     801  gacgccctcg ccgcagaccg tacgctgcaa agattgcgca agtggcaaga
     851  gcaaaggtgg gttaccttaa gaacacgcct gagaacaggt tgatctatca
     901  gagagttatg attgagatca tggacaaaga ctgcgtccgg tatgttgaca
     951  gggatgtcat attacctttg gctataggat gttgctttgt gtatccggat
    1001  ggagtagagg agtcggcggc actgtggggt tcttcggaat cccttggtgt
    1051  gaaataggga ggcctagtac gtctacctgg ggttgtaaca cagaccaata
    1101  gagatatccc atctggtgtg ttgcttcccc aggaggtgct agaggttcgt
    1151  acaggacctc ctaatgctaa ggaccgtaat atatttatgg ttgctggttg
    1201  cccatcacag gcacggttct tagtacacaa tcactgcctg aaaaacctaa
    1251  aaaggggtct tgtggagaga gttttctgtg tcgaaaagaa tggaattctc
    1301  actcgcactc cacaacctac caaaggagcc tttagtcgtc tttccccgtt
    1351  caggaaagca gtctgtgaga aggttggagt agcccaccga cttgggtatg
    1401  acgggtttct gtcatactac aacggtgcga aactccgtac ttacaaacgg
    1451  gctgtggaga gtctgcatat cacacctgtc tcggagaggg atagtcatct
    1501  gactaccttc gtcaaggcgg agaagatatc gacagctaag ggtgacccag
    1551  cacctagggt gatacagcct cgtaacccta ggtacaatgt cgagcttgga
    1601  agatatctac ggcatatgga atccaaactg atgaaagctg ttgatggcgt
    1651  atttggagaa acgacatgca tcaagggata tactgccgat gaggttggcg
    1701  ctatttttcg ggagaaatgg gacaggtttg ataaacctgt agccataggc
    1751  ctcgatgcgt caaggtttga tcaacactgt tccgtggagg ctttgcaatt
    1801  cgagcatagt ttctacaggg ctctgtaccc tggtaacaag cttttgagca
    1851  agttattgga ctggcaactc cataataaag gcaagggtta tgttcctgat
    1901  gggactatta cctatcgtaa ggagggctgc cgcatgagtg gggatataaa
    1951  cacctcgttg ggcaattatc tactaatgtg tgctatgatc tatggataca
    2001  tgcgtcattt ggggatcaat gagtttagtc tggcgaactg tggggatgat
    2051  tgtgttctaa ttgttgagcg caggaatctt aaacagatac agggcacact
    2101  gcctgagtat ttccttaacc taggatatac aatgaaggtg gaaaaacctg
    2151  tgtttcaatt ggaagaggtt gaattctgcc aggcacaccc cgtgcagttt
    2201  caaggtggtt ggaagatggt caggaatgtc cgcactgcaa tgagcaaaga
    2251  tgtgcactgc gtcaacaata tacgggatct cgctacgcgt agagcctgga
    2301  gcaatgcaca gcactttggg ggaagggctt tgacatccgg tatcccggtt
    2351  gttgataagt tctactctcg gtttgttgtg tatgatgccc ctaagaagca
    2401  tcaacgtatt gacacagtaa ccaacgtgca taagtggcgg ggatccggtg
    2451  gggcgtatac tgtgactcct gagtctaggg ctagtttttg ggctgccttt
    2501  ggactcacgg gggatgaaca gttggcactc gaggaccgtt tggacagatg
    2551  ggagatggat ctatttggag aggagggtgt tgacgctcat gagcccagca
    2601  tccttgactc cgccgtagca tgaccaagca agataagtta cacaatggca
    2651  atggtagcaa gaaacaacaa cacagcattg gtaccgtata gtggaggcaa
    2701  acgtggcctc cagaaagcat ttggatttgg agctacaatc gtcgggcaaa
    2751  agatttacga taatcgcggt aagattgtag ggttcatggt ggaacaagga
    2801  aagaaaggtt taagtaagat ggctaatgct ctcggttctg gcaatggtca
    2851  gaaagctcag aatctggttg gtgggatggg tggggccatt atggctcctg
    2901  ttgcggtttc gaggcagctt cgtggaagta aaccccggtt tactggacgc
    2951  acagctggtt ctgttactgt cacccaccgt gagtatgtac gacaggtaaa
    3001  caacacgtct gccttcacag tcaatggggg tattgtcggg aatttgtatc
    3051  aactgaaccc tttgaacggt actctgttca cttggttgcc ctccatagca
    3101  tccaattttg atcaatacgc gttcaataac atcacgttgc actatgtccc
    3151  cctctgtagt accactgagg taggtcgtgt tggattatat catgacaaag
    3201  actcacagga tcctgagcct actgataggc aggagttggc gaactttagt
    3251  acccttaaag agacaccccc ctggggtgaa gtaatgttgc gaatacccac
    3301  tgataggatc aagaggtact gcgatgacag taacgcagtc gatcataagc
    3351  taattgattt gggtcaagta ggcattgcta catatggggg tgctggcgct
    3401  aacgctgtag gtgatgtgtt tatatcgtat agtattactt tattctcacc
    3451  tcagcccact agctcattgc ttagcacaag acgacagagc cttctcggtg
    3501  ccactggtct tacgactggc ccgagttact tgacggtgtc cagcacggcg
    3551  accgttctca ccttgacgtt tagagctact ggcaccttta tggtctccgg
    3601  tcacttccgt gacactggag cagccgtatt aggtctcgct ggcaatatca
    3651  atgtaaactc actgacagtc ttggacacgg ttggcctggc cacctcgttc
    3701  tccattaatt gttcagtgtc tgctttaccg tctaccatta cctttacctc
    3751  cacagcaata acatcttcca cggtacactg tgtacgggcc gtaagggcca
    3801  atgatgccac attgttgtaa ctgcgtaaag ggcttcttga acaagaccag
    3851  ttcatggata ctgaatacga acaagtcaat aaaccatgga acgagctata
    3901  caaggaaacg acgctaggga acaagctaac agtgaacgtt ggaatggagg
    3951  atcaggaggt agcacttctc ccttcaaatt ttctgacgaa agtccgagtt
    4001  ggactgagtg gaggctacat aacgatgaga cgaattcgaa tcaggataac
    4051  ccccttggtt tcaaggaaag ctggggtttc gggaaagttg tatttaagag
    4101  atatctcaga tacgacggga cggaagcttc attgcacaga gtccttggat
    4151  cttggacggg agattcggtt aactatgcag catctcgatt tttcggtatc
    4201  aaccagatcg gatgtaccta tagtattcgg tttcgaggag ttagtgtcac
    4251  catttctgga gggtcgagaa ctcttcagca tctctgtgag atggcagttc
    4301  gggctaagca agaattgcta cagcttaccc cagtcgaagt ggaaagtgat
    4351  gtatcaagaa gatgccctga aggttttaaa accttcgaag aagaaagcga
    4401  gtaagacaga ctcttcagtc tgattgagtg gaagcaagca ctaacctaga
    4451  tagcatgtgg gttacttgca ctggcatgca gccgttatga tgacgagtca
    4501  ggtcgggctc tacggtgggt ttggtcgccc atgggacgga gatatggaaa
    4551  gggtctcgta cgctgtaaga ctaacttcgg ttgagcttgc gatatgggcc
    4601  tatgcctgga taagtcataa cattactgcc cagtgtaaat tggatgccaa
    4651  cttacaaccc taggagtact tgtggaacct catgatgaca cggttgatct
    4701  cacccttcgg gggggctata gagatcgctg gaagcactac cggacaaccg
    4751  gaacattgca gaaatgcagc cc