Sequence of DPV Saccharomyces cerevisiae virus L-A

Saccharomyces cerevisiae virus L-A-lus gag-pol fusion protein and coat protein genes, complete cds.

ACC No: JN819511

Dated: 2012-10-01 | Length: 4580 | CRC: -1844004661

                
ID   JN819511; SV 1; linear; genomic RNA; STD; VRL; 4580 BP.
XX
AC   JN819511;
XX
DT   01-OCT-2012 (Rel. 114, Created)
DT   01-OCT-2012 (Rel. 114, Last updated, Version 1)
XX
DE   Saccharomyces cerevisiae virus L-A-lus gag-pol fusion protein and coat
DE   protein genes, complete cds.
XX
KW   .
XX
OS   Saccharomyces cerevisiae virus L-A-lus
OC   Viruses; dsRNA viruses; Totiviridae; Totivirus.
XX
RN   [1]
RP   1-4580
RA   Esteban R., Rodriguez-Cousino N.;
RT   "L-A-lus, a new variant of L-A virus in wine yeast strains";
RL   Unpublished.
XX
RN   [2]
RP   1-4580
RA   Esteban R., Rodriguez-Cousino N.;
RT   ;
RL   Submitted (06-OCT-2011) to the INSDC.
RL   Instituto de Biologia Funcional y Genomica. CSIC, Avda. del Campo Charro
RL   s/n, Salamanca 37007, Spain
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4580
FT                   /organism="Saccharomyces cerevisiae virus L-A-lus"
FT                   /host="Saccharomyces cerevisiae wine strain EX229"
FT                   /mol_type="genomic RNA"
FT                   /country="Spain"
FT                   /collection_date="2005"
FT                   /db_xref="taxon:1226531"
FT   CDS             join(30. .1961,1961. .4546)
FT                   /codon_start=1
FT                   /ribosomal_slippage
FT                   /product="gag-pol fusion protein"
FT                   /protein_id="AFQ55381.1"
FT                   /translation="MLRFVTKNSQDKSSDLFSICSDKGTFVAHNRVRTDFKFDNLVFNR
FT                   VYGVSQKFTLVGNPKVCFNEGSSYLEGIAKKYLTLDGGLAIDNILNELKSTCGIPGNAV
FT                   ASHAYNITSWRWYDNHVALLMNMLRAYHLQVLSEQGQYSAGSYPMYHDGHVKIKLDTPI
FT                   SEDDAPDSFKWPSDRTTDTYPDWAQFSESFPSIDVPYLDVRPLTVTEVNFVLMMMSKWH
FT                   RRTNLAIDYEAPALADKFAYRHAITVQDADEWIEGDRTDDQFRPPSSKVMMSALRKYVN
FT                   HNRLYNQFYTAAQLLAQIMMKPVPNCAEGYAWLMHDALVNLPKFGSVRGRYPFLLAGDA
FT                   ALIQATALEDWSAIMAKPELIFTYAMQVAVALNTGLYLRRVKKTGFGTTVDDSYEDGAF
FT                   LQPETFVQAAIACCTGQDAPLNGMSDVYVTYPDLLEFDTITRVPVTVLEPEGYNIQDGA
FT                   LEVTGVPIACSPYMIFPVAAFDEANPYSGSFVIKPALKYLRKGALYAKLEAWKLAWAMR
FT                   IAGYDTEFKACGNTHGLSKFYADNSDSWTHIPEFVSDEEVTEVYVTNIERRARHFVELP
FT                   RLNSPAFFKPVEVSTAIYDTYVQAGTFSVYHASRINLDYVKPVSAGIQVINAGELRNYW
FT                   GSVRRTQQGFRSGRSYDASRNAYRRTYSWHCPRRLDRTDGKCFSRVNIIEPSHGPRPMR
FT                   YILNEPNTYPAWIRFRNRVQAVSRQRATHFLFDIVPASKIADYTTSQTATFAYRSHTYA
FT                   CTVTALRFGDDYGLYVQVEANMTLLSPAARRQASATYSQVEGFCFNTPTVMDTLANILD
FT                   VDRNIRPKHFKGLRTYERSKVTAQHHTHLRPDEVLEAAARVSPRRKYYLLCVVELLAAC
FT                   EVNIEAAVATIMTYVLTLDEKFIPLFLDSRTIWQGSKGPEELTARLKKASGQIKSVHTA
FT                   DYEPLTELFELAVLMNRGVGHVSWKTEREHRENPDVANVNQQALYACVRDMFEGAKQTY
FT                   DYPYMTWDDYTSSRWEWVPGGSVHSQYSEDDEYIFPGQYTRNKFITVNKMPKHKIARMI
FT                   ASTPEVRAWTSTKYEWGKQRAIYGTDLRSTLITNFAMFRCEDVLTHKFPVGDQAEAAKV
FT                   HKRVNMMLDGASSFCFDYDDFNSQHSISSMYTVLCAFRDAFTRNMSIEQREAMDWVCES
FT                   VKHMWVLDPDTKTWYQLKGTLLSGWRLTTFMNTVLNWAYKKLAGVFDLDDVQDSVHNGD
FT                   DVMISLNRVSTAVRIMDAMHRINARAQPAKCNLFSISEFLRVEHGMSGGDGLGAQYLSR
FT                   SCATLVHSRIESNEPLSVVRVMEADKTRLRDLANRTNIKASVTEIEEQLDRRVTSIFKV
FT                   DREVVKAISTAHRVCGGISTDPWAPVTTKIKTDNEAYEIPYEIDDPSFWPGVNDYAYKV
FT                   WQNFGERLEFNKIKDAVSKGSRNTIALKRKAKISAVKNDFVNKSEWERTMYKAYKGLAV
FT                   SYYANLSKFMSIPPMANIEFGQARFAMQAALDSSDPLRALQIFL"
FT   CDS             30. .2072
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /note="major virion coat protein"
FT                   /protein_id="AFQ55380.1"
FT                   /translation="MLRFVTKNSQDKSSDLFSICSDKGTFVAHNRVRTDFKFDNLVFNR
FT                   VYGVSQKFTLVGNPKVCFNEGSSYLEGIAKKYLTLDGGLAIDNILNELKSTCGIPGNAV
FT                   ASHAYNITSWRWYDNHVALLMNMLRAYHLQVLSEQGQYSAGSYPMYHDGHVKIKLDTPI
FT                   SEDDAPDSFKWPSDRTTDTYPDWAQFSESFPSIDVPYLDVRPLTVTEVNFVLMMMSKWH
FT                   RRTNLAIDYEAPALADKFAYRHAITVQDADEWIEGDRTDDQFRPPSSKVMMSALRKYVN
FT                   HNRLYNQFYTAAQLLAQIMMKPVPNCAEGYAWLMHDALVNLPKFGSVRGRYPFLLAGDA
FT                   ALIQATALEDWSAIMAKPELIFTYAMQVAVALNTGLYLRRVKKTGFGTTVDDSYEDGAF
FT                   LQPETFVQAAIACCTGQDAPLNGMSDVYVTYPDLLEFDTITRVPVTVLEPEGYNIQDGA
FT                   LEVTGVPIACSPYMIFPVAAFDEANPYSGSFVIKPALKYLRKGALYAKLEAWKLAWAMR
FT                   IAGYDTEFKACGNTHGLSKFYADNSDSWTHIPEFVSDEEVTEVYVTNIERRARHFVELP
FT                   RLNSPAFFKPVEVSTAIYDTYVQAGTFSVYHASRINLDYVKPVSAGIQVINAGELRNYW
FT                   GSVRRTQQGLGVVGLTMPAVMPTGERTAGTAHEDLIEQTENVSVE"
XX
SQ   Sequence 4580 BP; 1342 A; 970 C; 1090 G; 1178 T; 0 other;

jn819511 Length: 4580  01-OCT-2012  Type: N  Check: 6070  ..

       1  gaaaaatttg aataatcata taactcccca tgcttagatt cgttaccaaa
      51  aactctcaag acaagtcctc cgatttattt tctatttgct ctgacaaagg
     101  tacttttgtt gcgcataata gggtgaggac tgactttaaa tttgacaact
     151  tagtttttaa tcgagtctac ggcgtgtcac aaaagttcac cctagtcggc
     201  aacccgaaag tctgtttcaa tgagggaagt tcgtacttgg agggtattgc
     251  aaagaaatat ctgaccttgg acggtggcct ggccattgat aacatcctca
     301  atgaattgaa atcaacatgt ggtataccag gtaatgctgt cgcttctcat
     351  gcatacaaca ttacgtcttg gagatggtac gataatcacg tggcattact
     401  catgaatatg ttacgtgcgt accatcttca agtgttatct gaacaaggcc
     451  agtattctgc cggttcatac cctatgtacc acgatgggca tgtcaaaatt
     501  aaacttgaca ctcctatcag tgaggatgat gctcctgact catttaagtg
     551  gccgagtgac cggacaacag acacttaccc agactgggct cagttctcag
     601  agtccttccc gtctattgac gtcccatact tagatgtcag gccacttact
     651  gttaccgaag ttaattttgt gttaatgatg atgagtaagt ggcaccgtcg
     701  gactaacctt gctattgact atgaagcgcc ggcgctggca gacaaattcg
     751  cctaccgtca cgccattacg gtccaggatg cagatgaatg gattgaaggt
     801  gataggacag atgatcagtt tagaccacct tcttctaagg taatgatgtc
     851  ggcattgcgt aagtatgtta atcataatcg actttacaac cagttctata
     901  cggccgctca actattagct cagattatga tgaaaccagt acctaactgc
     951  gctgaagggt atgcatggtt gatgcacgat gctctggtca acttgccgaa
    1001  gttcgggtcc gttagagggc gttacccgtt cttacttgca ggtgacgctg
    1051  ccctgattca ggcaacagca cttgaagact ggtcagcaat tatggctaag
    1101  ccagaactga tttttaccta cgctatgcag gttgctgtcg cgttgaacac
    1151  tggcttatac ttacggaggg tcaagaaaac tggtttcggt accactgttg
    1201  acgatagtta tgaagacggc gcatttctac aacctgagac cttcgtacaa
    1251  gctgcgatag cttgctgcac tggccaagat gcaccgctta acggtatgtc
    1301  tgatgtgtac gtgacatacc cagatctcct tgagttcgat actataacac
    1351  gtgtccctgt tacggtacta gaacctgaag gctataatat acaggatggc
    1401  gccttggaag tgacaggtgt tccgattgcc tgctcgcctt acatgatttt
    1451  ccctgtcgca gctttcgatg aagctaaccc ctattctggt agttttgtta
    1501  ttaagcctgc gctgaaatac ctacgcaaag gtgctctgta tgccaaacta
    1551  gaggcctgga aactggcctg ggctatgagg attgcaggat acgacactga
    1601  atttaaagct tgtggcaaca cgcatggttt atccaaattt tatgctgata
    1651  atagcgatag ttggacacac ataccggaat tcgttagtga tgaagaagtt
    1701  acggaagtgt atgtaactaa tattgaacgt agagccagac actttgttga
    1751  gctaccaaga ctaaattctc cagccttttt taaaccagta gaggtaagca
    1801  ccgcaattta cgatacttac gtacaggcag gcacattctc tgtctaccat
    1851  gcaagcagga ttaatttgga ttacgtcaag cctgtatctg caggcataca
    1901  agtcattaac gctggtgaac taaggaatta ctggggtagt gtacgccgta
    1951  cgcagcaggg tttaggagtg gtaggtctta cgatgccagc cgtaatgcct
    2001  accggagaac gtacagctgg cactgcccac gaagacttga tcgaacagac
    2051  ggaaaatgtt tcagtcgagt aaacataata gaaccatccc atgggcctcg
    2101  tccgatgaga tacatattga acgagccaaa tacatacccc gcatggataa
    2151  ggttcagaaa tagagtacag gcggtatcta gacagagggc aacacatttc
    2201  ttatttgata tagtaccggc cagcaaaatt gcggactata ctacttcaca
    2251  aacggctact tttgcataca ggtcgcacac gtatgcatgc acggtaacgg
    2301  cactacgctt tggagatgac tacggcttgt atgtccaggt agaggctaac
    2351  atgacattgt taagtccggc tgcacggcga caagcttctg ctacgtactc
    2401  tcaggttgag gggttctgtt ttaacacacc tacggtcatg gacacgctag
    2451  ctaacatctt ggatgttgac cgcaatatta gaccaaagca ctttaaaggt
    2501  ctgcgtactt atgagaggtc taaggtcaca gcacaacacc acactcactt
    2551  gcggcctgat gaagtactgg aagcagcggc acgtgtatcg cctaggcgaa
    2601  agtactactt attatgcgtc gtagagctat tagcggcatg cgaggttaac
    2651  attgaagcag cagtagctac aataatgacg tacgtactca ctttggacga
    2701  aaagttcata cctttgtttc tagactcacg gacaatatgg cagggtagta
    2751  aaggacctga agaactaaca gccagactca agaaggcgag cgggcagatt
    2801  aaaagtgttc atacagctga ctatgagcca ctgacggaac tgtttgaatt
    2851  ggctgtgctc atgaacagag gcgtcgggca tgtatcctgg aagactgaaa
    2901  gagaacacag agagaatccg gatgtagcaa acgttaatca acaagcactc
    2951  tacgcgtgcg tacgtgacat gttcgagggg gccaagcaga cttatgatta
    3001  tccttacatg acatgggatg actatacgtc aagtcggtgg gaatgggtgc
    3051  ctggaggaag tgttcattct cagtactccg aggatgatga atatatattt
    3101  ccaggacaat atactaggaa caagtttatt acagtcaaca aaatgcctaa
    3151  gcataagatc gcgcgtatga tagcatctac gcctgaagtt agggcatgga
    3201  cctcaacgaa gtatgaatgg ggtaaacaaa gagctatata tggcacagac
    3251  ctacggagca cacttatcac taacttcgct atgttcagat gtgaagatgt
    3301  gttaacacat aaatttcctg taggtgatca agctgaagct gcgaaggtcc
    3351  acaaacgtgt caacatgatg ctagacggtg catcgagttt ctgttttgat
    3401  tacgacgact ttaattccca gcattcaata agcagcatgt acacagtact
    3451  atgtgctttc agagacgctt tcacacgtaa tatgtccatt gaacaacgcg
    3501  aggctatgga ttgggtatgt gagtcagtca agcacatgtg ggttttagat
    3551  ccggatacta agacttggta ccaattgaag ggcaccttgt tatcaggatg
    3601  gcgactcaca acatttatga acacagtgtt aaattgggca tacaagaagc
    3651  tggctggggt atttgattta gatgacgtcc aagattcagt acataacggc
    3701  gatgatgtca tgattagttt aaacagagtc agtacagccg ttagaataat
    3751  ggacgcgatg catagaatca atgctagggc ccagccggct aagtgtaacc
    3801  tgttctctat aagcgaattc ttacgcgtag agcatgggat gagcggaggt
    3851  gacggcttag gagctcagta cttaagtcgg tcatgcgcca cactggttca
    3901  cagccgtata gagtcgaacg agccactatc tgttgtccgg gttatggaag
    3951  cagacaaaac gcggctacgg gacttggcta acaggaccaa cattaaagca
    4001  tcagtaacag aaatagaaga gcaacttgat cgtagagtca cttcgatatt
    4051  caaagtggat agagaagtag tcaaagcgat ttctacagct cacagagtct
    4101  gcggcggtat atcaaccgac ccgtgggcac cagttactac aaaaataaag
    4151  acagacaacg aagcatacga aataccatac gaaatagatg atccatcatt
    4201  ttggccaggg gtaaacgatt atgcttataa agtctggcag aatttcggcg
    4251  aaaggctgga gtttaacaag attaaagacg ctgtttcaaa gggcagcaga
    4301  aacacgatag ccttgaaacg taaggcgaag atttctgcag tcaagaacga
    4351  cttcgtcaat aaatctgaat gggagagaac tatgtacaaa gcttacaaag
    4401  gtttagcagt atcttattat gctaacttga gcaaattcat gagcatacca
    4451  cccatggcaa acatagaatt cggacaagct agatttgcga tgcaggcggc
    4501  cttagatagt tccgatcctt taagagcact acaaatattc ttatgaagtg
    4551  ctcgaacgat gagggttttt acccatatgc