Sequence of DPV Apple chlorotic leaf spot virus
Apple chlorotic leaf spot virus isolate SQ5 coat protein gene, complete cds.
ACC No: JN848989
Dated: 2012-04-05 | Length: 582 | CRC: 521339854
ID JN848989; SV 1; linear; genomic RNA; STD; VRL; 582 BP. XX AC JN848989; XX DT 05-FEB-2012 (Rel. 111, Created) DT 05-APR-2012 (Rel. 112, Last updated, Version 2) XX DE Apple chlorotic leaf spot virus isolate SQ5 coat protein gene, complete DE cds. XX KW . XX OS Apple chlorotic leaf spot virus OC Viruses; ssRNA positive-strand viruses, no DNA stage; Tymovirales; OC Betaflexiviridae; Trichovirus. XX RN [1] RP 1-582 RX DOI; 10.1007/s00705-011-1195-5. RX PUBMED; 22278708. RA Niu F., Pan S., Wu Z., Jiang D., Li S.; RT "Complete nucleotide sequences of the genomes of two isolates of apple RT chlorotic leaf spot virus from peach (Prunus persica) in China"; RL Arch. Virol. 157(4):783-786(2012). XX RN [2] RP 1-582 RA Niu F., Pan S., Wu Z., Li S.; RT ; RL Submitted (12-OCT-2011) to the INSDC. RL State Key Laboratory of Biology of Plant Diseases and Insect Pests, RL Institute of Plant Protection, Chinese Academy of Agricultural Sciences, RL Yuanmingyuan Road West 2, Haidian, Beijing 100193, China XX FH Key Location/Qualifiers FH FT source 1. .582 FT /organism="Apple chlorotic leaf spot virus" FT /isolate="SQ5" FT /mol_type="genomic RNA" FT /country="China" FT /collected_by="Shifang Li" FT /collection_date="23-Jun-2011" FT /clone="SQ5-1" FT /db_xref="taxon:12175" FT CDS 1. .582 FT /codon_start=1 FT /product="coat protein" FT /protein_id="AEZ03867.1" FT /translation="MAATLNLQLKVDTELRAFLAEANRPLHGKTGGTVELILESIFANI FT AVQGTSEQTEFLDVEVEVKRSGDPTVLQKYNLRTVVELIKLFRTTSSDKNINILTFRQI FT CEAFAPEARDGLVKLKTIGVLTNLYKTMPEVGNKYPELMFDFNKGLNPMLMNKTQRVVV FT TNLNRRLLQTEFAKSENEAKIASVSNDLCI" XX SQ Sequence 582 BP; 175 A; 127 C; 148 G; 132 T; 0 other; jn848989 Length: 582 05-APR-2012 Type: N Check: 2974 .. 1 atggccgcaa ctttgaacct acagctgaag gtggacacgg aattgagagc 51 tttcctagcg gaagccaatc gccccctgca tggaaagaca gggggaacag 101 tggaactgat actggagtcc atcttcgcaa acatcgcggt tcaaggaacg 151 tcagagcaaa cagaatttct cgacgtggaa gtcgaggtga aaaggagtgg 201 ggatcccaca gtgctgcaga agtacaatct gaggacggtc gtggagctga 251 tcaagctttt tcggactacg tcttcggaca agaacatcaa catccttact 301 tttaggcaga tatgcgaagc cttcgctccg gaagccagag atgggttggt 351 caaactcaag acaattggtg tcttgaccaa tctatacaag accatgccgg 401 aggtgggcaa caaatatccc gaactcatgt ttgacttcaa caaagggctt 451 aacccgatgt taatgaataa gactcaaaga gtggttgtta ccaaccttaa 501 ccggcgcctt ttacagactg aatttgcaaa aagtgagaac gaggcaaaga 551 ttgcttcagt ttctaacgat ttgtgcattt aa