Sequence of DPV Apple chlorotic leaf spot virus
Apple chlorotic leaf spot virus isolate G2 coat protein gene, complete cds.
ACC No: JN849000
Dated: 2012-04-05 | Length: 582 | CRC: -1725899113
ID JN849000; SV 1; linear; genomic RNA; STD; VRL; 582 BP. XX AC JN849000; XX DT 05-FEB-2012 (Rel. 111, Created) DT 05-APR-2012 (Rel. 112, Last updated, Version 2) XX DE Apple chlorotic leaf spot virus isolate G2 coat protein gene, complete cds. XX KW . XX OS Apple chlorotic leaf spot virus OC Viruses; ssRNA positive-strand viruses, no DNA stage; Tymovirales; OC Betaflexiviridae; Trichovirus. XX RN [1] RP 1-582 RX DOI; 10.1007/s00705-011-1195-5. RX PUBMED; 22278708. RA Niu F., Pan S., Wu Z., Jiang D., Li S.; RT "Complete nucleotide sequences of the genomes of two isolates of apple RT chlorotic leaf spot virus from peach (Prunus persica) in China"; RL Arch. Virol. 157(4):783-786(2012). XX RN [2] RP 1-582 RA Niu F., Pan S., Wu Z., Li S.; RT ; RL Submitted (12-OCT-2011) to the INSDC. RL State Key Laboratory of Biology of Plant Diseases and Insect Pests, RL Institute of Plant Protection, Chinese Academy of Agricultural Sciences, RL Yuanmingyuan Road West 2, Haidian, Beijing 100193, China XX FH Key Location/Qualifiers FH FT source 1. .582 FT /organism="Apple chlorotic leaf spot virus" FT /isolate="G2" FT /mol_type="genomic RNA" FT /country="China" FT /collected_by="Shifang Li" FT /collection_date="05-Jul-2011" FT /clone="G2-1" FT /db_xref="taxon:12175" FT CDS 1. .582 FT /codon_start=1 FT /product="coat protein" FT /protein_id="AEZ03878.1" FT /translation="MAATLNLQLKVDAELRAFLAEANRPLHGKTGGTVELILESIFANI FT AVQGTSEQTEFLDVEVEVKMSGDPTVLQKYNLKTVVGLIKLFRTTSSDKNINTLTFRQI FT CEAFAPEARDGLVKLKTIGVLTNLYKTMPEVGNKYPELMFDFNKGLNPMLMNKTQRVVV FT TNLNRRLLQTEFAKSENEAKIASVSNDLCI" XX SQ Sequence 582 BP; 174 A; 123 C; 149 G; 136 T; 0 other; jn849000 Length: 582 05-APR-2012 Type: N Check: 7734 .. 1 atggccgcaa ctttgaacct gcagctgaag gtggacgcgg aattgagagc 51 ctttctggcg gaagccaatc gtcccttgca tggaaagaca gggggaacag 101 tggaactgat actggagtcc atcttcgcaa acatcgcggt ccaaggaacg 151 tcagagcaga cagaatttct agacgtggaa gtcgaagtga aaatgagtgg 201 ggatcccaca gtgctgcaga agtacaatct gaagacagtc gtggggctga 251 tcaagctttt ccggactaca tcttcggaca agaacatcaa tacccttacc 301 tttaggcaga tatgcgaagc tttcgctccg gaggctagag atgggctggt 351 caaactcaag acaatcggtg ttttgaccaa tctttacaag acaatgcctg 401 aagtgggcaa taaatatcca gagctcatgt ttgacttcaa taaagggctt 451 aacccaatgc taatgaataa aacccagagg gtggttgtca ccaacctcaa 501 ccggcgtctt ttacagactg agtttgcaaa aagtgagaat gaagcaaaga 551 ttgcttcagt ttctaatgat ttgtgcattt ag