Sequence of DPV Grapevine leafroll-associated virus 2
Grapevine leafroll-associated virus 2 isolate G63 coat protein (CP) gene, complete cds.
ACC No: JN865252
Dated: 2012-02-27 | Length: 597 | CRC: 985654088
ID JN865252; SV 1; linear; genomic RNA; STD; VRL; 597 BP. XX AC JN865252; XX DT 27-FEB-2012 (Rel. 111, Created) DT 27-FEB-2012 (Rel. 111, Last updated, Version 1) XX DE Grapevine leafroll-associated virus 2 isolate G63 coat protein (CP) gene, DE complete cds. XX KW . XX OS Grapevine leafroll-associated virus 2 OC Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae; OC Closterovirus. XX RN [1] RP 1-597 RA Komorowska B., Golis T.; RT "Molecular characterization of the coat protein gene of Grapevine RT leafroll-associated virus 2"; RL Unpublished. XX RN [2] RP 1-597 RA Komorowska B., Golis T.; RT ; RL Submitted (18-OCT-2011) to the INSDC. RL Plant Protection, Research Institute of Horticulture, Konstytucji 3Maja RL 1/3, Skierniewice, Lodzkie 96-100, Poland XX FH Key Location/Qualifiers FH FT source 1. .597 FT /organism="Grapevine leafroll-associated virus 2" FT /host="Vitis vinifera" FT /isolate="G63" FT /mol_type="genomic RNA" FT /country="Poland" FT /collection_date="21-Jul-2010" FT /db_xref="taxon:64003" FT gene 1. .597 FT /gene="CP" FT CDS 1. .597 FT /codon_start=1 FT /gene="CP" FT /product="coat protein" FT /protein_id="AFB74643.1" FT /translation="MELMSDSNLSNLVITDASSLNGVDKKLLSAEVVKMLVQKGAPNEG FT IEVVFGLLLYALAARTTSPKVQRADSDVIFSNSFGERNVVVTEGDLKKVLDGCAPLTRF FT TNKLRTFGRTFTEAYVDFCIAYKHKLPQLNAAAELGIPAEDSYLAADFLGTCPKLSELQ FT QSRKMFASMYALKTEGGVVNTPVSNLRQLGRREVM" XX SQ Sequence 597 BP; 161 A; 122 C; 160 G; 154 T; 0 other; jn865252 Length: 597 27-FEB-2012 Type: N Check: 9933 .. 1 atggagttga tgtccgacag caaccttagc aacctggtga taaccgacgc 51 ctctagtcta aatggtgtcg acaagaagct tttatctgct gaagttgtaa 101 aaatgttggt gcagaaaggg gctcctaacg agggtataga agtggtgttc 151 ggtctactcc tttacgcact cgcggcaaga accacgtctc ctaaggttca 201 gcgcgcagat tcagacgtta tattttcaaa tagtttcgga gagaggaatg 251 tggtagtaac agagggcgac cttaagaagg tactcgacgg gtgtgcgcct 301 ctcactaggt tcactaataa acttagaacg ttcggtcgta ctttcactga 351 ggcttatgtt gacttttgca tcgcgtataa gcacaaatta ccccaactca 401 acgccgcggc ggaattgggg attccagctg aagattcgta cttagctgca 451 gattttctgg gtacttgccc gaagctctct gaattacagc aaagtaggaa 501 gatgttcgcg agtatgtacg ctctaaaaac tgaaggtggg gtggtaaata 551 cgccggtgag caatctgcgt cagctaggta gaagggaagt tatgtaa