Sequence of DPV Grapevine leafroll-associated virus 2

Grapevine leafroll-associated virus 2 isolate G22 coat protein (CP) gene, complete cds.

ACC No: JN865253

Dated: 2012-02-27 | Length: 597 | CRC: 1280158488

                
ID   JN865253; SV 1; linear; genomic RNA; STD; VRL; 597 BP.
XX
AC   JN865253;
XX
DT   27-FEB-2012 (Rel. 111, Created)
DT   27-FEB-2012 (Rel. 111, Last updated, Version 1)
XX
DE   Grapevine leafroll-associated virus 2 isolate G22 coat protein (CP) gene,
DE   complete cds.
XX
KW   .
XX
OS   Grapevine leafroll-associated virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-597
RA   Komorowska B., Golis T.;
RT   "Molecular characterization of the coat protein gene of Grapevine
RT   leafroll-associated virus 2";
RL   Unpublished.
XX
RN   [2]
RP   1-597
RA   Komorowska B., Golis T.;
RT   ;
RL   Submitted (18-OCT-2011) to the INSDC.
RL   Plant Protection, Research Institute of Horticulture, Konstytucji 3Maja
RL   1/3, Skierniewice, Lodzkie 96-100, Poland
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .597
FT                   /organism="Grapevine leafroll-associated virus 2"
FT                   /host="Vitis vinifera"
FT                   /isolate="G22"
FT                   /mol_type="genomic RNA"
FT                   /country="Poland"
FT                   /collection_date="28-Jul-2011"
FT                   /db_xref="taxon:64003"
FT   gene            1. .597
FT                   /gene="CP"
FT   CDS             1. .597
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="AFB74644.1"
FT                   /translation="MELMSDSNLSNLVITDASSLNGVDKKLLSAEVVKMLVQKGAPNEG
FT                   IEVVFGLLLYALAARTTSPKVQRADSDVIFSNSFGERNVVVTEGDLKKVLDGCAPLTRF
FT                   TNKLRTFGRTFTEAYVDFCIAYKHKLPQLNAAAELGIPAEDSYLAADFLGTCPKLSELQ
FT                   QSRKMFASMYALKTEGGVVNTPVSNLRQLGRREVM"
XX
SQ   Sequence 597 BP; 163 A; 121 C; 158 G; 155 T; 0 other;

jn865253 Length: 597  27-FEB-2012  Type: N  Check: 476  ..

       1  atggagttga tgtccgacag caaccttagc aacctggtga taaccgacgc
      51  ctctagtcta aatggtgtcg acaagaagct tttatctgct gaagttgtaa
     101  aaatgttggt gcagaaaggg gctcctaacg agggtataga agtggtgttc
     151  ggtctactcc tttacgcgct cgcggcaaga accacgtctc ctaaggttca
     201  gcgcgcagat tcagacgtta tattttcaaa tagtttcgga gagaggaatg
     251  tggtagtaac agagggtgac cttaagaagg tactcgacgg gtgtgcgcct
     301  ctcactaggt tcactaataa acttagaacg ttcggtcgta ctttcactga
     351  ggcttacgtt gacttttgta tcgcgtataa gcacaaatta ccccaactca
     401  acgccgcggc ggaattgggg attccagctg aagattcgta cttagctgca
     451  gattttctgg gtacttgccc gaagctctct gaattacagc aaagtaggaa
     501  gatgttcgcg agtatgtacg ctctaaaaac tgaaggtgga gtggtaaata
     551  caccagtgag caatctgcgt cagctaggta gaagggaagt tatgtaa