Sequence of DPV Pelargonium leaf curl virus

Pelargonium leaf curl virus isolate PLCV-A coat protein gene, complete cds.

ACC No: JN871217

Dated: 2011-12-22 | Length: 1188 | CRC: -1814537692

                
ID   JN871217; SV 1; linear; genomic RNA; STD; VRL; 1188 BP.
XX
AC   JN871217;
XX
DT   22-DEC-2011 (Rel. 111, Created)
DT   22-DEC-2011 (Rel. 111, Last updated, Version 1)
XX
DE   Pelargonium leaf curl virus isolate PLCV-A coat protein gene, complete cds.
XX
KW   .
XX
OS   Pelargonium leaf curl virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-1188
RA   Alemzadeh E., Izadpanah K.;
RT   "Identification of Pelargonium leaf curl virus and Moroccan pepper virus
RT   into natural host plants in Iran";
RL   Unpublished.
XX
RN   [2]
RP   1-1188
RA   Alemzadeh E., Izadpanah K.;
RT   ;
RL   Submitted (19-OCT-2011) to the INSDC.
RL   Plant Virology Research Center, Virology, Bajgah, Shiraz, Bajgah 0098 711,
RL   Iran
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1188
FT                   /organism="Pelargonium leaf curl virus"
FT                   /host="Avena sativa"
FT                   /isolate="PLCV-A"
FT                   /mol_type="genomic RNA"
FT                   /country="Iran"
FT                   /collected_by="Alemzadeh, E"
FT                   /collection_date="10-Apr-2009"
FT                   /identified_by="Alemzadeh, E., Izadpanah, K."
FT                   /db_xref="taxon:35280"
FT   CDS             1. .1170
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="AEW27313.1"
FT                   /translation="MAMVRRNNNTSIIPVTGMQLATIVGTAVAGAVGNVVKNNGGAIAR
FT                   TAVGFGKQAVKRFRRRKGGGNQQMIQHVGGTGGAVMVPVAVTRQLMGSKPKFTGRMSGS
FT                   VTVTHREYLTQVNNTTAFAVNGGIVDNLLQLNPLNGTLFAWLPAIASNFDQYTFNNVVL
FT                   HYVPLCATTEVGRVAMYFDKDSEDVEPADRVELANYGVLKETAPWAEATLNIPCDRIKR
FT                   YCDDSATVDHKLIDLGQLGIATYGGSGTNAIGDVFISYSVTLYYPQPTNSLLSTRRLDL
FT                   TGASLNGNGPGYTIVSRTPTVISMTFRSTGTFVLTGAYRCLTASTLGLTGSVNVNSITV
FT                   LDTLGLATSFIINCTVSSLPSVVSFTSTGITSATINCVRATRANVVTLA"
XX
SQ   Sequence 1188 BP; 318 A; 265 C; 294 G; 311 T; 0 other;

jn871217 Length: 1188  22-DEC-2011  Type: N  Check: 4051  ..

       1  atggcaatgg tacgtagaaa taacaacaca tcaattatac cagtcactgg
      51  catgcagttg gcaactattg ttggcactgc ggtagctgga gctgtcggaa
     101  atgtcgtgaa gaacaatggt ggggcaatag cgagaacagc cgttggtttt
     151  gggaagcaag cagtaaaaag atttagaaga agaaaaggag gaggaaatca
     201  gcagatgata caacatgtag gtggtacagg tggggcagtt atggtcccgg
     251  tggcagtgac tagacaactc atgggaagta agcctaaatt cacaggtaga
     301  atgtccggat ctgtcacagt aacccaccgt gagtacctaa ctcaggtcaa
     351  taacaccact gcgtttgcgg taaatggggg gatcgtcgac aatttgttac
     401  agctcaaccc gttgaatggg acactgttcg catggttacc ggctatagcc
     451  tctaactttg accagtacac attcaacaat gttgtgctac attatgtacc
     501  cctgtgcgcc accactgagg tgggacgtgt ggcaatgtac tttgataagg
     551  actcggagga tgttgaacct gctgatagag ttgagttggc taattacgga
     601  gtgctcaaag agacagcccc ctgggctgaa gcaaccctga atatcccttg
     651  tgatcggatt aagagatact gtgatgacag tgctactgta gatcataaac
     701  ttatcgactt gggacagctg ggcatagcta catatggtgg ctccgggact
     751  aacgctattg gagatgtttt catttcctat agtgtcacgt tatattaccc
     801  tcaacctacg aactctctcc ttagtactag gcgccttgat ctcacaggtg
     851  cttccctcaa tggcaatgga cctggataca ctattgtgtc ccgaacaccc
     901  actgttatca gtatgacctt caggtctact ggcacgtttg tcttgaccgg
     951  ggcgtatcgg tgcttaactg catctactct cggacttact ggcagcgtga
    1001  atgtgaacag cattacggta ttggatacac ttggactagc aactagtttc
    1051  attatcaatt gcacagtgtc ctcattaccg tctgttgtca gcttcacatc
    1101  taccggcatc acctctgcca ccataaactg cgttagagct actagagcaa
    1151  atgttgttac actagcataa tcttctctag aggggcct