Sequence of DPV Pelargonium leaf curl virus

Pelargonium leaf curl virus isolate PLCV-D coat protein gene, complete cds.

ACC No: JN871218

Dated: 2011-12-22 | Length: 1188 | CRC: 1558031369

                
ID   JN871218; SV 1; linear; genomic RNA; STD; VRL; 1188 BP.
XX
AC   JN871218;
XX
DT   22-DEC-2011 (Rel. 111, Created)
DT   22-DEC-2011 (Rel. 111, Last updated, Version 1)
XX
DE   Pelargonium leaf curl virus isolate PLCV-D coat protein gene, complete cds.
XX
KW   .
XX
OS   Pelargonium leaf curl virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-1188
RA   Alemzadeh E., Izadpanah K.;
RT   "Identification of Pelargonium leaf curl virus and Moroccan pepper virus
RT   into natural host plants in Iran";
RL   Unpublished.
XX
RN   [2]
RP   1-1188
RA   Alemzadeh E., Izadpanah K.;
RT   ;
RL   Submitted (19-OCT-2011) to the INSDC.
RL   Plant Virology Research Center, Virology, Bajgah, Shiraz, Bajgah 0098 711,
RL   Iran
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1188
FT                   /organism="Pelargonium leaf curl virus"
FT                   /host="Dianthus barbatus"
FT                   /isolate="PLCV-D"
FT                   /mol_type="genomic RNA"
FT                   /country="Iran"
FT                   /collected_by="Alemzadeh, E"
FT                   /collection_date="10-Apr-2009"
FT                   /identified_by="Alemzadeh, E., Izadpanah, K."
FT                   /db_xref="taxon:35280"
FT   CDS             1. .1170
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="AEW27314.1"
FT                   /translation="MAMVRRNNNTSIIPVTGMQLAAIVGTAVAGAVGNVVKNNGGAIAR
FT                   TAVGFGKQVVKRFRRRKGGGNQQMIQHVGGTGGAVMAPVAVTRQLMGSKPKFTGRMSGS
FT                   VTVTHREYLTQVNNTTAFAVNEGIVDNLLQLNPLNGTLFAWLPAIASNFDQYTFNNVVL
FT                   HYVPLCATTEVGRVAMYFDKDSEDVEPADRVELANYGVLKETAPWAEATLNIPCDRIKR
FT                   YCDDSATVDHKLIDLGQLGTATYGGSGTNAIEDVFISYSVTLYYPQPTNSLLSTRRLDL
FT                   TGASLNGNGPGYTIVSRTPTVISMTFRSTGTFVLTGAYRCLTASTLGLTGSVNVNSITV
FT                   LDTLGLATSFIINCTVSSLPSVVSFTSTGITSATINCVGATRANVVTLA"
XX
SQ   Sequence 1188 BP; 317 A; 266 C; 295 G; 310 T; 0 other;

jn871218 Length: 1188  22-DEC-2011  Type: N  Check: 4764  ..

       1  atggcaatgg tacgtagaaa taacaacaca tcaattatac cagtcactgg
      51  catgcagttg gcagctattg ttggcactgc ggtagctgga gctgtcggaa
     101  atgtcgtgaa gaacaatggt ggggcaatag cgagaacagc cgttggtttt
     151  gggaagcaag tagtaaaaag atttagaaga agaaaaggag gaggaaatca
     201  gcagatgata caacatgtag gtggtacagg tggggcagtt atggccccgg
     251  tggcggtgac tagacaactc atgggaagta agcctaaatt cacaggtaga
     301  atgtctggat ctgtcacagt aacccaccgt gagtacctaa ctcaggtcaa
     351  taacaccact gcgtttgcgg taaatgaggg gattgtcgac aatttgttac
     401  agctcaaccc gttgaatggg acactgttcg catggttacc ggctatagcc
     451  tctaactttg accagtacac attcaacaat gttgtgctac attatgtacc
     501  cctgtgcgcc accactgagg tgggacgtgt ggcaatgtac tttgataagg
     551  actcggagga tgttgaacct gccgatagag ttgagttggc taattacgga
     601  gtgctcaaag agacagcccc ctgggctgaa gcaaccctga atatcccttg
     651  tgatcggatt aagagatact gtgatgacag tgctactgta gatcataaac
     701  ttatcgactt gggacagctg ggcacagcta catatggtgg ctccgggact
     751  aacgctatcg aagatgtttt catttcctat agtgtcacgt tatattaccc
     801  tcaacctacg aactctctcc ttagtactag gcgccttgat ctcacaggtg
     851  cttccctcaa tggcaatgga cctggataca ctattgtgtc ccgaacaccc
     901  actgttatca gtatgacctt caggtctact ggcacgtttg tcttgaccgg
     951  ggcgtatcgg tgcttaactg catctactct cggacttact ggcagcgtga
    1001  atgtgaacag cattacggta ttggatacac ttggactagc aactagtttc
    1051  attatcaatt gcacagtgtc ctcattaccg tctgttgtca gcttcacatc
    1101  taccggcatc acctctgcca ccataaactg cgttggagct actagagcaa
    1151  atgttgttac actagcataa tcttctctag aggggcct